Search Templates to Model Hetero Multimers

[Back to HOMCOS] [help]
proteinA TITLERecName: Full=Cyclin-dependent-like kinase 5; EC=2.7.11.1;AltName: Full=Cell division protein kinase 5;AltName: Full=Serine/threonine-protein kinase PSSALRE;AltName: Full=Tau protein kinase II catalytic subunit; Short=TPKII catalytic subunit;
UniProt_ID for query CDK5_HUMAN
QUERYSEQ
(length 292)
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA
FGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
BLAST Nsbjseq 500 [show plain BLAST file]
proteinB TITLERecName: Full=G2/mitotic-specific cyclin-B1;
UniProt_ID for query CCNB1_HUMAN
QUERYSEQ
(length 433)
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVI
LAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
BLAST Nsbjseq 230 [show plain BLAST file]
precalc_bltT minNca0 minRca0 Nmodel215

Homologous hetero-multimer found by BLAST

asmbl:assembly_id    Npro:number of proteins homologous to query A or B
identity[%]:sequence identity only for the contact residues. Number after the slash /  is sequence identity for all the aligned region.
Ncon:number of aligned contact residues. Number after the slath / is number of contact residues in the template homologue.
PDB Protein A Protein B
id asmbl Npro N asym oper UniProtID 292aa
identity[%] Ncon N asym oper UniProtID 433aa
identity[%] Ncon
2jgz 12-mer 1 A 1 CDK2_HUMAN 60.0/ 61.230/301 B 1 CCNB1_HUMAN 100.0/100.0 29/29
5hq0 12-mer 1 A 1 CDK1_HUMAN 62.5/ 58.024/241 B 1 CCNB1_HUMAN 100.0/ 98.9 23/23
4y72 12-mer 1 A 1 CDK1_HUMAN 62.5/ 58.024/241 B 1 CCNB1_HUMAN 100.0/ 98.9 23/23
4yc3 12-mer 1 A 1 CDK1_HUMAN 61.5/ 57.126/261 B 1 CCNB1_HUMAN 100.0/ 98.9 25/25
5lqf 12-mer 1 A 1 CDK1_HUMAN 60.7/ 57.028/291 B 1 CCNB1_HUMAN 100.0/ 98.9 29/29
5lqf 22-mer 1 D 1 CDK1_HUMAN 61.5/ 56.626/271 E 1 CCNB1_HUMAN 100.0/ 98.9 28/28
1w98 12-mer 1 A 1 CDK2_HUMAN 71.4/ 60.735/351 B 1 CCNE1_HUMAN 27.6/ 40.5 29/39
5l2w 12-mer 1 A 1 CDK2_HUMAN 70.6/ 60.734/341 B 1 CCNE1_HUMAN 34.4/ 40.5 32/44
4bco 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.730/301 B 1 CCNA2_BOVIN 44.8/ 39.8 29/30
4bco 22-mer 1 C 1 CDK2_HUMAN 60.6/ 56.433/331 D 1 CCNA2_BOVIN 48.3/ 39.8 29/29
4bcn 12-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 50.0/ 39.8 30/30
4bcq 12-mer 1 C 1 CDK2_HUMAN 60.7/ 60.028/281 D 1 CCNA2_BOVIN 42.3/ 39.8 26/26
3f5x 42-mer 1 C 1 CDK2_HUMAN 65.6/ 60.732/321 D 1 CCNA2_HUMAN 51.7/ 39.6 29/31
2i40 22-mer 1 C 1 CDK2_HUMAN 64.5/ 60.731/311 D 1 CCNA2_HUMAN 53.8/ 39.6 26/28
2bpm 22-mer 1 C 1 CDK2_HUMAN 65.6/ 60.732/321 D 1 CCNA2_HUMAN 53.8/ 39.6 26/28
2bkz 22-mer 1 C 1 CDK2_HUMAN 65.7/ 60.735/351 D 1 CCNA2_HUMAN 48.1/ 39.6 27/29
1vyw 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.733/331 D 1 CGA2_HUMAN 51.9/ 39.6 27/29
1oi9 22-mer 1 C 1 CDK2_HUMAN 59.4/ 60.732/321 D 1 CGA2_HUMAN 48.1/ 39.6 27/27
4bck 22-mer 1 C 1 CDK2_HUMAN 60.7/ 60.028/281 D 1 CCNA2_HUMAN 48.1/ 39.6 27/27
2iw8 22-mer 1 C 1 CDK2_HUMAN 63.6/ 55.733/331 D 1 CCNA2_HUMAN 50.0/ 39.6 28/28
2iw6 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.333/331 D 1 CCNA2_HUMAN 51.9/ 39.6 27/27
4eoi 22-mer 1 C 1 CDK2_HUMAN 60.6/ 60.033/331 D 1 CCNA2_HUMAN 50.0/ 39.6 28/28
1ogu 22-mer 1 C 1 CDK2_HUMAN 62.5/ 56.432/321 D 1 CGA2_HUMAN 48.1/ 39.6 27/27
3eid 22-mer 1 C 1 CDK2_HUMAN 66.7/ 59.724/241 D 1 CCNA2_HUMAN 50.0/ 39.6 24/25
2iw9 12-mer 1 C 1 CDK2_HUMAN 63.9/ 56.436/361 D 1 CCNA2_HUMAN 51.7/ 39.6 29/29
2wip 22-mer 1 C 1 CDK2_HUMAN 63.6/ 59.033/331 D 1 CCNA2_HUMAN 50.0/ 39.6 28/30
2wpa 22-mer 1 C 1 CDK2_HUMAN 62.1/ 60.729/291 D 1 CCNA2_HUMAN 53.6/ 39.5 28/29
1h27 12-mer 1 A 1 CDK2_HUMAN 60.6/ 60.733/331 B 1 CGA2_HUMAN 44.8/ 39.4 29/29
1h27 22-mer 1 C 1 CDK2_HUMAN 60.6/ 60.133/331 D 1 CGA2_HUMAN 45.2/ 39.4 31/31
3f5x 18-mer 4 A 3 A 4 C 1 C 2 CDK2_HUMAN 62.5/ 60.732/324 B 3 B 4 D 1 D 2 CCNA2_HUMAN 48.7/ 39.4 29/31
3f5x 32-mer 1 A 1 CDK2_HUMAN 65.5/ 60.729/291 B 1 CCNA2_HUMAN 50.0/ 39.4 28/30
3f5x 24-mer 2 A 4 C 1 CDK2_HUMAN 62.5/ 60.732/322 B 4 D 1 CCNA2_HUMAN 48.7/ 39.4 29/31
2whb 12-mer 1 A 1 CDK2_HUMAN 62.1/ 60.729/291 B 1 CCNA2_HUMAN 50.0/ 39.4 28/30
2whb 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.730/301 D 1 CCNA2_HUMAN 50.0/ 39.4 28/30
2c5x 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CCNA2_HUMAN 50.0/ 39.4 26/29
2c5x 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.730/301 D 1 CCNA2_HUMAN 51.7/ 39.4 29/31
2i40 12-mer 1 A 1 CDK2_HUMAN 61.3/ 60.031/311 B 1 CCNA2_HUMAN 50.0/ 39.4 28/31
1urc 12-mer 1 A 1 CDK2_HUMAN 65.6/ 60.732/321 B 1 CGA2_HUMAN 55.6/ 39.4 27/29
1urc 22-mer 1 C 1 CDK2_HUMAN 65.5/ 60.729/291 D 1 CGA2_HUMAN 51.9/ 39.4 27/29
1ol2 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CG2A_HUMAN 46.9/ 39.4 32/35
1ol2 22-mer 1 C 1 CDK2_HUMAN 68.8/ 60.732/321 D 1 CG2A_HUMAN 50.0/ 39.4 30/32
1ol1 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.733/331 B 1 CG2A_HUMAN 48.0/ 39.4 25/28
1ol1 22-mer 1 C 1 CDK2_HUMAN 65.6/ 60.732/321 D 1 CG2A_HUMAN 51.7/ 39.4 29/31
1okw 12-mer 1 A 1 CDK2_HUMAN 62.5/ 60.732/321 B 1 CG2A_HUMAN 46.4/ 39.4 28/30
1okw 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.730/301 D 1 CG2A_HUMAN 51.9/ 39.4 27/29
1okv 12-mer 1 A 1 CDK2_HUMAN 64.7/ 60.734/341 B 1 CG2A_HUMAN 46.7/ 39.4 30/33
1okv 22-mer 1 C 1 CDK2_HUMAN 63.3/ 60.730/301 D 1 CG2A_HUMAN 50.0/ 39.4 30/32
2c5n 12-mer 1 A 1 CDK2_HUMAN 64.5/ 60.731/311 B 1 CCNA2_HUMAN 52.2/ 39.4 23/26
2c5n 22-mer 1 C 1 CDK2_HUMAN 59.4/ 60.732/321 D 1 CCNA2_HUMAN 48.1/ 39.4 27/28
2c5o 12-mer 1 A 1 CDK2_HUMAN 59.4/ 60.732/321 B 1 CCNA2_HUMAN 50.0/ 39.4 30/32
2c5o 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.733/331 D 1 CCNA2_HUMAN 50.0/ 39.4 28/30
2v22 14-mer 2 A 1 C 1 CDK2_HUMAN 58.1/ 60.732/322 B 1 D 1 CCNA2_HUMAN 44.7/ 39.4 27/29
2wev 12-mer 1 A 1 CDK2_HUMAN 61.8/ 60.734/341 B 1 CCNA2_HUMAN 50.0/ 39.4 28/31
2wev 22-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 51.9/ 39.4 27/29
2x1n 12-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 55.2/ 39.4 29/32
2x1n 22-mer 1 A 1 CDK2_HUMAN 58.8/ 60.734/341 B 1 CCNA2_HUMAN 48.3/ 39.4 29/32
2uue 12-mer 1 A 1 CDK2_HUMAN 60.6/ 60.733/331 B 1 CCNA2_HUMAN 53.8/ 39.4 26/28
2uue 22-mer 1 C 1 CDK2_HUMAN 61.3/ 60.731/311 D 1 CCNA2_HUMAN 53.6/ 39.4 28/30
5if1 14-mer 2 A 1 C 1 CDK2_HUMAN 56.1/ 60.730/302 B 1 D 1 CCNA2_HUMAN 53.8/ 39.4 28/29
2c5v 12-mer 1 A 1 CDK2_HUMAN 65.6/ 60.732/321 B 1 CCNA2_HUMAN 57.7/ 39.4 26/29
2c5v 22-mer 1 C 1 CDK2_HUMAN 61.3/ 60.731/311 D 1 CCNA2_HUMAN 56.0/ 39.4 25/27
2wfy 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CCNA2_HUMAN 50.0/ 39.4 28/29
2wfy 22-mer 1 C 1 CDK2_HUMAN 62.5/ 60.732/321 D 1 CCNA2_HUMAN 48.4/ 39.4 31/33
4fx3 12-mer 1 A 1 CDK2_HUMAN 68.8/ 60.732/321 B 1 CCNA2_HUMAN 53.6/ 39.4 28/30
4fx3 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.733/331 D 1 CCNA2_HUMAN 53.6/ 39.4 28/30
1fin 12-mer 1 A 1 CDK2_HUMAN 71.1/ 60.738/381 B 1 CCNA2_HUMAN 50.0/ 39.4 26/31
1fin 22-mer 1 C 1 CDK2_HUMAN 68.6/ 60.735/351 D 1 CCNA2_HUMAN 53.8/ 39.4 26/30
1fvv 12-mer 1 A 1 CDK2_HUMAN 70.6/ 60.734/341 B 1 CCNA2_HUMAN 48.3/ 39.4 29/34
1fvv 22-mer 1 C 1 CDK2_HUMAN 60.5/ 60.738/381 D 1 CCNA2_HUMAN 51.9/ 39.4 27/31
2c4g 12-mer 1 A 1 CDK2_HUMAN 69.2/ 60.726/261 B 1 CCNA2_HUMAN 54.2/ 39.4 24/25
2c4g 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.733/331 D 1 CCNA2_HUMAN 53.8/ 39.4 26/28
2bpm 12-mer 1 A 1 CDK2_HUMAN 73.3/ 60.730/301 B 1 CCNA2_HUMAN 55.6/ 39.4 27/29
2wxv 12-mer 1 C 1 CDK2_HUMAN 63.3/ 60.730/301 D 1 CCNA2_HUMAN 51.9/ 39.4 27/29
2wxv 22-mer 1 A 1 CDK2_HUMAN 65.5/ 60.729/291 B 1 CCNA2_HUMAN 59.3/ 39.4 27/29
2bkz 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CCNA2_HUMAN 48.3/ 39.4 29/31
2wih 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.730/301 B 1 CCNA2_HUMAN 53.6/ 39.4 28/30
2wih 22-mer 1 C 1 CDK2_HUMAN 64.7/ 60.734/341 D 1 CCNA2_HUMAN 50.0/ 39.4 28/29
1vyw 12-mer 1 A 1 CDK2_HUMAN 68.8/ 60.732/321 B 1 CGA2_HUMAN 51.7/ 39.4 29/31
2wpa 12-mer 1 A 1 CDK2_HUMAN 67.7/ 60.731/311 B 1 CCNA2_HUMAN 51.7/ 39.4 29/30
1e9h 12-mer 1 A 1 CDK2_HUMAN 59.5/ 60.737/371 B 1 CGA2_HUMAN 43.3/ 39.4 30/31
1e9h 22-mer 1 C 1 CDK2_HUMAN 60.0/ 60.735/351 D 1 CGA2_HUMAN 43.3/ 39.4 30/31
1pkd 12-mer 1 A 1 CDK2_HUMAN 62.2/ 60.737/371 B 1 CCNA2_HUMAN 46.4/ 39.4 28/29
1pkd 22-mer 1 C 1 CDK2_HUMAN 58.8/ 60.734/341 D 1 CCNA2_HUMAN 46.9/ 39.4 32/33
2cch 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.733/331 B 1 CCNA2_HUMAN 50.0/ 39.4 30/33
2cch 22-mer 1 C 1 CDK2_HUMAN 70.0/ 60.730/301 D 1 CCNA2_HUMAN 48.3/ 39.4 29/29
1qmz 14-mer 2 A 1 C 1 CDK2_HUMAN 55.0/ 60.733/332 B 1 D 1 CG2A_HUMAN 44.7/ 39.4 29/30
1p5e 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CCNA2_HUMAN 48.3/ 39.4 29/29
1p5e 22-mer 1 C 1 CDK2_HUMAN 61.1/ 60.736/361 D 1 CCNA2_HUMAN 45.2/ 39.4 31/32
2cci 12-mer 1 A 1 CDK2_HUMAN 58.8/ 60.734/341 B 1 CCNA2_HUMAN 45.2/ 39.4 31/32
2cci 22-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 48.4/ 39.4 31/32
4eos 12-mer 1 A 1 CDK2_HUMAN 69.0/ 60.729/291 B 1 CCNA2_HUMAN 48.3/ 39.4 29/29
4eos 22-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 46.7/ 39.4 30/31
1oi9 12-mer 1 A 1 CDK2_HUMAN 62.9/ 60.335/351 B 1 CGA2_HUMAN 46.4/ 39.4 28/29
1oiy 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.333/331 B 1 CGA2_HUMAN 50.0/ 39.4 28/29
1oiy 22-mer 1 C 1 CDK2_HUMAN 63.9/ 60.736/361 D 1 CGA2_HUMAN 48.1/ 39.4 27/28
1h24 12-mer 1 A 1 CDK2_HUMAN 60.6/ 60.733/331 B 1 CGA2_HUMAN 53.3/ 39.4 30/30
1h24 22-mer 1 C 1 CDK2_HUMAN 62.9/ 60.735/351 D 1 CGA2_HUMAN 46.7/ 39.4 30/31
1h25 12-mer 1 A 1 CDK2_HUMAN 60.6/ 60.733/331 B 1 CGA2_HUMAN 50.0/ 39.4 32/32
1h25 22-mer 1 C 1 CDK2_HUMAN 63.6/ 58.833/331 D 1 CGA2_HUMAN 45.2/ 39.4 31/32
4cfm 12-mer 1 A 1 CDK2_HUMAN 61.8/ 60.734/341 B 1 CCNA2_HUMAN 48.3/ 39.4 29/30
4cfm 22-mer 1 C 1 CDK2_HUMAN 62.5/ 56.032/321 D 1 CCNA2_HUMAN 46.7/ 39.4 30/31
5nev 12-mer 1 A 1 CDK2_HUMAN 64.7/ 60.734/341 B 1 CCNA2_HUMAN 46.7/ 39.4 30/31
5nev 22-mer 1 C 1 CDK2_HUMAN 65.7/ 60.735/351 D 1 CCNA2_HUMAN 48.4/ 39.4 31/32
1h1r 12-mer 1 A 1 CDK2_HUMAN 60.0/ 60.735/351 B 1 CGA2_HUMAN 44.8/ 39.4 29/29
1h1r 22-mer 1 C 1 CDK2_HUMAN 57.6/ 60.733/331 D 1 CGA2_HUMAN 46.4/ 39.4 28/29
1h1s 12-mer 1 A 1 CDK2_HUMAN 59.5/ 60.737/371 B 1 CGA2_HUMAN 46.4/ 39.4 28/29
1h1s 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.733/331 D 1 CGA2_HUMAN 50.0/ 39.4 28/29
1h1p 12-mer 1 A 1 CDK2_HUMAN 57.6/ 60.733/331 B 1 CGA2_HUMAN 45.2/ 39.4 31/31
1h1p 22-mer 1 C 1 CDK2_HUMAN 61.1/ 60.736/361 D 1 CGA2_HUMAN 44.8/ 39.4 29/29
1h1q 12-mer 1 A 1 CDK2_HUMAN 67.6/ 60.734/341 B 1 CGA2_HUMAN 50.0/ 39.4 32/33
1h1q 22-mer 1 C 1 CDK2_HUMAN 64.7/ 60.734/341 D 1 CGA2_HUMAN 46.9/ 39.4 32/33
2wmb 12-mer 1 A 1 CDK2_HUMAN 57.1/ 60.735/351 B 1 CCNA2_HUMAN 46.7/ 39.4 30/31
2wmb 22-mer 1 C 1 CDK2_HUMAN 61.3/ 55.731/311 D 1 CCNA2_HUMAN 50.0/ 39.4 28/30
5cyi 12-mer 1 A 1 CDK2_HUMAN 64.7/ 60.734/341 B 1 CCNA2_HUMAN 46.4/ 39.4 28/29
5cyi 22-mer 1 C 1 CDK2_HUMAN 61.8/ 60.734/341 D 1 CCNA2_HUMAN 46.4/ 39.4 28/28
1h28 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.733/331 B 1 CGA2_HUMAN 46.7/ 39.4 30/31
1h28 22-mer 1 C 1 CDK2_HUMAN 61.8/ 60.734/341 D 1 CGA2_HUMAN 45.2/ 39.4 31/32
2wma 12-mer 1 A 1 CDK2_HUMAN 68.6/ 60.735/351 B 1 CCNA2_HUMAN 46.4/ 39.4 28/29
2wma 22-mer 1 C 1 CDK2_HUMAN 61.5/ 55.739/391 D 1 CCNA2_HUMAN 47.1/ 39.4 34/36
3ddp 12-mer 1 C 1 CDK2_HUMAN 61.5/ 60.739/391 D 1 CCNA2_BOVIN 48.4/ 39.4 31/36
3ddp 22-mer 1 A 1 CDK2_HUMAN 62.5/ 60.740/401 B 1 CCNA2_BOVIN 50.0/ 39.4 28/33
2g9x 12-mer 1 A 1 CDK2_HUMAN 60.0/ 60.740/401 B 1 CCNA2_BOVIN 50.0/ 39.4 28/33
2g9x 22-mer 1 C 1 CDK2_HUMAN 63.2/ 56.738/381 D 1 CCNA2_BOVIN 46.7/ 39.4 30/35
4bck 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.727/271 B 1 CCNA2_HUMAN 50.0/ 39.4 26/26
2uzl 12-mer 1 A 1 CDK2_HUMAN 62.5/ 60.732/321 B 1 CCNA2_HUMAN 44.8/ 39.4 29/29
2uzl 22-mer 1 C 1 CDK2_HUMAN 62.5/ 60.732/321 D 1 CCNA2_HUMAN 48.4/ 39.4 31/31
2uze 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.733/331 B 1 CCNA2_HUMAN 48.3/ 39.4 29/29
2uze 22-mer 1 C 1 CDK2_HUMAN 63.3/ 60.730/301 D 1 CCNA2_HUMAN 51.7/ 39.4 29/29
4bcp 12-mer 1 A 1 CDK2_HUMAN 65.5/ 60.729/291 B 1 CCNA2_HUMAN 50.0/ 39.4 26/26
4bcp 22-mer 1 C 1 CDK2_HUMAN 60.6/ 55.333/331 D 1 CCNA2_HUMAN 46.7/ 39.4 30/30
4cfw 12-mer 1 C 1 CDK2_HUMAN 59.4/ 60.732/321 D 1 CCNA2_HUMAN 42.9/ 39.4 28/28
4cfw 22-mer 1 A 1 CDK2_HUMAN 64.5/ 60.731/311 B 1 CCNA2_HUMAN 44.8/ 39.4 29/29
4bcm 12-mer 1 A 1 CDK2_HUMAN 63.3/ 60.330/301 B 1 CCNA2_HUMAN 51.7/ 39.4 29/29
4bcn 22-mer 1 A 1 CDK2_HUMAN 64.5/ 60.731/311 B 1 CCNA2_HUMAN 53.6/ 39.4 28/28
1h26 12-mer 1 A 1 CDK2_HUMAN 60.6/ 60.733/331 B 1 CGA2_HUMAN 50.0/ 39.4 30/31
1h26 22-mer 1 C 1 CDK2_HUMAN 60.6/ 56.433/331 D 1 CGA2_HUMAN 46.7/ 39.4 30/30
4cfx 12-mer 1 C 1 CDK2_HUMAN 67.7/ 60.731/311 D 1 CCNA2_HUMAN 41.4/ 39.4 29/32
4cfx 22-mer 1 A 1 CDK2_HUMAN 62.1/ 60.729/291 B 1 CCNA2_HUMAN 46.4/ 39.4 28/29
1jst 14-mer 2 A 1 C 1 CDK2_HUMAN 56.5/ 60.733/332 B 1 D 1 CCNA2_HUMAN 47.6/ 39.4 31/31
1jst 32-mer 1 C 1 CDK2_HUMAN 60.6/ 60.733/331 D 1 CCNA2_HUMAN 48.4/ 39.4 31/31
1jst 22-mer 1 A 1 CDK2_HUMAN 60.0/ 60.735/351 B 1 CCNA2_HUMAN 46.7/ 39.4 30/32
4cfv 12-mer 1 C 1 CDK2_HUMAN 61.0/ 55.341/411 D 1 CCNA2_HUMAN 48.3/ 39.4 29/34
4cfv 22-mer 1 A 1 CDK2_HUMAN 63.9/ 60.736/361 B 1 CCNA2_HUMAN 51.7/ 39.4 29/34
2c6t 12-mer 1 A 1 CDK2_HUMAN 56.7/ 60.730/301 B 1 CCNA2_HUMAN 46.7/ 39.4 30/31
2c6t 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.733/331 D 1 CCNA2_HUMAN 51.6/ 39.4 31/32
2uzd 12-mer 1 A 1 CDK2_HUMAN 60.0/ 60.730/301 B 1 CCNA2_HUMAN 44.4/ 39.4 27/28
2uzd 22-mer 1 C 1 CDK2_HUMAN 61.3/ 60.731/311 D 1 CCNA2_HUMAN 50.0/ 39.4 30/31
2uzb 12-mer 1 A 1 CDK2_HUMAN 58.6/ 60.729/291 B 1 CCNA2_HUMAN 46.2/ 39.4 26/27
2uzb 22-mer 1 C 1 CDK2_HUMAN 61.5/ 60.726/261 D 1 CCNA2_HUMAN 51.9/ 39.4 27/28
1gy3 12-mer 1 A 1 CDK2_HUMAN 60.0/ 60.730/301 B 1 CGA2_HUMAN 44.8/ 39.4 29/30
1gy3 22-mer 1 C 1 CDK2_HUMAN 58.1/ 60.731/311 D 1 CGA2_HUMAN 41.4/ 39.4 29/30
4eop 12-mer 1 A 1 CDK2_HUMAN 66.7/ 60.330/301 B 1 CCNA2_HUMAN 50.0/ 39.4 28/28
4eop 22-mer 1 C 1 CDK2_HUMAN 61.8/ 60.334/341 D 1 CCNA2_HUMAN 46.4/ 39.4 28/29
4eoo 12-mer 1 A 1 CDK2_HUMAN 67.7/ 60.031/311 B 1 CCNA2_HUMAN 48.1/ 39.4 27/27
4eoo 22-mer 1 C 1 CDK2_HUMAN 57.6/ 60.333/331 D 1 CCNA2_HUMAN 46.9/ 39.4 32/32
3ddq 12-mer 1 C 1 CDK2_HUMAN 61.5/ 55.739/391 D 1 CCNA2_BOVIN 50.0/ 39.4 26/31
3ddq 22-mer 1 A 1 CDK2_HUMAN 64.9/ 60.737/371 B 1 CCNA2_BOVIN 53.6/ 39.4 28/33
5lmk 12-mer 1 A 1 CDK2_HUMAN 65.6/ 60.732/321 B 1 CCNA2_HUMAN 51.9/ 39.4 27/28
3bht 12-mer 1 A 1 CDK2_HUMAN 63.2/ 60.738/381 B 1 CCNA2_BOVIN 48.3/ 39.4 29/34
3bht 22-mer 1 C 1 CDK2_HUMAN 61.0/ 56.441/411 D 1 CCNA2_BOVIN 48.3/ 39.4 29/34
3bhu 12-mer 1 A 1 CDK2_HUMAN 63.2/ 60.738/381 B 1 CCNA2_BOVIN 46.7/ 39.4 30/35
3bhu 22-mer 1 C 1 CDK2_HUMAN 60.0/ 56.440/401 D 1 CCNA2_BOVIN 48.3/ 39.4 29/34
3bhv 12-mer 1 A 1 CDK2_HUMAN 63.2/ 60.738/381 B 1 CCNA2_BOVIN 45.2/ 39.4 31/36
3bhv 22-mer 1 C 1 CDK2_HUMAN 61.0/ 56.441/411 D 1 CCNA2_BOVIN 48.3/ 39.4 29/34
4cfu 12-mer 1 A 1 CDK2_HUMAN 62.2/ 60.737/371 B 1 CCNA2_HUMAN 46.7/ 39.4 30/35
2iw6 12-mer 1 A 1 CDK2_HUMAN 61.3/ 60.031/311 B 1 CCNA2_HUMAN 51.7/ 39.4 29/29
3dog 22-mer 1 A 1 CDK2_HUMAN 60.0/ 60.340/401 B 1 CCNA2_BOVIN 51.9/ 39.4 27/32
4eon 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.033/331 B 1 CCNA2_HUMAN 53.3/ 39.4 30/30
4eon 22-mer 1 C 1 CDK2_HUMAN 61.3/ 60.031/311 D 1 CCNA2_HUMAN 46.9/ 39.4 32/32
3eoc 12-mer 1 A 1 CDK2_HUMAN 73.1/ 60.326/261 B 1 CCNA2_HUMAN 55.6/ 39.4 27/29
3eoc 22-mer 1 C 1 CDK2_HUMAN 66.7/ 60.327/271 D 1 CCNA2_HUMAN 48.1/ 39.4 27/30
3ej1 12-mer 1 A 1 CDK2_HUMAN 70.0/ 60.330/301 B 1 CCNA2_HUMAN 50.0/ 39.4 28/30
3ej1 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.333/331 D 1 CCNA2_HUMAN 51.7/ 39.4 29/32
2cjm 12-mer 1 C 1 CDK2_HUMAN 63.9/ 60.336/361 D 1 CCNA2_HUMAN 46.9/ 39.4 32/32
2cjm 22-mer 1 A 1 CDK2_HUMAN 66.7/ 59.730/301 B 1 CCNA2_HUMAN 48.4/ 39.4 31/31
4eoi 12-mer 1 A 1 CDK2_HUMAN 68.8/ 59.732/321 B 1 CCNA2_HUMAN 50.0/ 39.4 26/26
4eoq 12-mer 1 A 1 CDK2_HUMAN 64.5/ 60.331/311 B 1 CCNA2_HUMAN 51.7/ 39.4 29/29
4eoq 22-mer 1 C 1 CDK2_HUMAN 59.4/ 56.432/321 D 1 CCNA2_HUMAN 48.3/ 39.4 29/29
4eok 12-mer 1 A 1 CDK2_HUMAN 70.0/ 59.730/301 B 1 CCNA2_HUMAN 42.9/ 39.4 28/28
4eok 22-mer 1 C 1 CDK2_HUMAN 64.5/ 60.031/311 D 1 CCNA2_HUMAN 44.8/ 39.4 29/29
4eol 12-mer 1 A 1 CDK2_HUMAN 67.7/ 59.731/311 B 1 CCNA2_HUMAN 51.9/ 39.4 27/27
4eol 22-mer 1 C 1 CDK2_HUMAN 62.5/ 60.032/321 D 1 CCNA2_HUMAN 46.7/ 39.4 30/30
1oiu 12-mer 1 A 1 CDK2_HUMAN 62.5/ 60.332/321 B 1 CGA2_HUMAN 50.0/ 39.4 28/28
1oiu 22-mer 1 C 1 CDK2_HUMAN 62.9/ 55.735/351 D 1 CGA2_HUMAN 46.7/ 39.4 30/30
3tnw 12-mer 1 A 1 CDK2_HUMAN 63.6/ 60.333/331 B 1 CCNA2_BOVIN 46.7/ 39.4 30/30
3tnw 22-mer 1 C 1 CDK2_HUMAN 63.6/ 60.033/331 D 1 CCNA2_BOVIN 48.4/ 39.4 31/31
4eor 12-mer 1 A 1 CDK2_HUMAN 70.0/ 60.330/301 B 1 CCNA2_HUMAN 48.1/ 39.4 27/27
4eor 22-mer 1 C 1 CDK2_HUMAN 64.7/ 56.734/341 D 1 CCNA2_HUMAN 44.8/ 39.4 29/30
3my5 12-mer 1 A 1 CDK2_HUMAN 63.2/ 60.338/381 B 1 CCNA2_BOVIN 46.7/ 39.4 30/35
3my5 22-mer 1 C 1 CDK2_HUMAN 59.0/ 56.039/391 D 1 CCNA2_BOVIN 48.3/ 39.4 29/34
3eid 12-mer 1 A 1 CDK2_HUMAN 68.0/ 60.025/251 B 1 CCNA2_HUMAN 50.0/ 39.4 28/30
4bcq 22-mer 1 A 1 CDK2_HUMAN 66.7/ 59.027/271 B 1 CCNA2_BOVIN 46.2/ 39.4 26/26
4eom 12-mer 1 A 1 CDK2_HUMAN 62.5/ 59.732/321 B 1 CCNA2_HUMAN 50.0/ 39.4 30/30
4eom 22-mer 1 C 1 CDK2_HUMAN 59.4/ 55.732/321 D 1 CCNA2_HUMAN 44.8/ 39.4 29/29
4eoj 12-mer 1 A 1 CDK2_HUMAN 66.7/ 59.730/301 B 1 CCNA2_HUMAN 48.1/ 39.4 27/27
4eoj 22-mer 1 C 1 CDK2_HUMAN 61.8/ 57.034/341 D 1 CCNA2_HUMAN 50.0/ 39.4 28/28
2wip 12-mer 1 A 1 CDK2_HUMAN 64.3/ 59.028/281 B 1 CCNA2_HUMAN 51.6/ 39.4 31/33
1jsu 12-mer 1 A 1 CDK2_HUMAN 58.8/ 60.834/341 B 1 CCNA2_HUMAN 50.0/ 39.4 30/32
5lmk 22-mer 1 C 1 CDK2_HUMAN 61.8/ 55.734/341 D 1 CCNA2_HUMAN 48.3/ 39.4 29/29
3dog 12-mer 1 C 1 CDK2_HUMAN 60.5/ 56.038/381 D 1 CCNA2_BOVIN 45.2/ 39.2 31/33
1ogu 12-mer 1 A 1 CDK2_HUMAN 61.3/ 60.331/311 B 1 CGA2_HUMAN 50.0/ 39.2 26/26
2iw8 12-mer 1 A 1 CDK2_HUMAN 58.8/ 60.734/341 B 1 CCNA2_HUMAN 48.1/ 39.0 27/27
4cfn 12-mer 1 C 1 CDK2_HUMAN 65.6/ 60.732/321 D 1 CCNA2_HUMAN 44.8/ 39.0 29/29
4cfn 22-mer 1 A 1 CDK2_HUMAN 62.5/ 60.332/321 B 1 CCNA2_HUMAN 50.0/ 39.0 28/28
2iw9 22-mer 1 A 1 CDK2_HUMAN 65.5/ 60.029/291 B 1 CCNA2_HUMAN 56.0/ 39.0 25/26
4cfu 22-mer 1 C 1 CDK2_HUMAN 60.0/ 56.440/401 D 1 CCNA2_HUMAN 41.2/ 38.9 34/34
4bcm 22-mer 1 C 1 CDK2_HUMAN 62.5/ 60.732/321 D 1 CCNA2_HUMAN 44.8/ 37.6 29/30
3qhr 12-mer 1 A 1 CDK2_HUMAN 61.8/ 60.734/341 B 1 CCNA2_MOUSE 44.8/ 37.6 29/34
3qhr 22-mer 1 C 1 CDK2_HUMAN 61.8/ 60.734/341 D 1 CCNA2_MOUSE 46.4/ 37.6 28/32
3qhw 12-mer 1 A 1 CDK2_HUMAN 61.1/ 60.736/361 B 1 CCNA2_MOUSE 44.8/ 37.6 29/34
3qhw 22-mer 1 C 1 CDK2_HUMAN 62.9/ 60.735/351 D 1 CCNA2_MOUSE 44.8/ 37.6 29/34
4i3z 12-mer 1 A 1 CDK2_HUMAN 65.6/ 60.732/321 B 1 CCNA2_MOUSE 44.4/ 37.6 27/29
4i3z 22-mer 1 C 1 CDK2_HUMAN 62.5/ 60.732/321 D 1 CCNA2_MOUSE 44.4/ 37.6 27/29
4ii5 12-mer 1 A 1 CDK2_HUMAN 63.3/ 60.730/301 B 1 CCNA2_MOUSE 44.8/ 37.6 29/30
4ii5 22-mer 1 C 1 CDK2_HUMAN 63.3/ 60.730/301 D 1 CCNA2_MOUSE 44.8/ 37.6 29/30