Protein Model on 5hq0 assembly_id=1 (TEMPLATE: 5hq0 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A) b(query B)
1 a A(CDKL1_HUMAN) A 1 (A) polymer(polypeptide(L)) [292 aa] Cyclin-dependent kinase 1 :CDK1_HUMAN 169E 170Y 173D 174I 177Y 178L 253F 257K 258Y 259E 260E 265E 266I 283R 286E 287M 291R 294N 295F 297L 298G 299R 304H (identity: 100.0 %/98.9 %)
2 b B(CCNB1_HUMAN) B 1 (B) polymer(polypeptide(L)) [264 aa] G2/mitotic-specific cyclin-B1 :CCNB1_HUMAN 40E 41D(E) 42D(E) 43P(G) 44V 47K(S) 50L(I) 51R 53I 54R(S) 57K 58Q(E) 72R(M) 116N(V) 119H 120K(S) 121H(R) 122N(R) 151L(A) 152L(F) 154G(I) 278T(S) 279C(G) 280E(K) (identity: 25.0 %/46.4 %)
3 c C 1 (C) polymer(polypeptide(L)) [74 aa] Cyclin-dependent kinases regulatory subunit 2 :CKS2_HUMAN 161D(H) 206K(D) 207S 208D(E) 209V(I) 210D 213Y(F) 249P(D) 251E(K) 253K(T) 254F 255P (identity: 33.3 %/46.4 %)
4 d D 1 (A) non-polymer(LZ9) {[(2,6-difluorophenyl)carbonyl]amino}-N-(4-fluorophenyl)-1H-pyrazole-3-carboxamide 11I 16Y 19V 32A 34K 65V 81F 82E 83Y(F) 84C(L) 85D(S) 86H(M) 87T(D) 90H(K) 131E(Q) 132N 134L 144C(A) 145D (identity: 57.9 %/46.4 %)
ALIGNMENTS
MODEL[1] Protein A "CDKL1_HUMAN" TEMPLATE:5hq0_A_1 identity=46.4%
CDKL1_HUMAN    2:MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKF-LESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRG--:  98
                :** * ** ***** **** * *   *** ** **  ****   *    * ***  ** * *** * *  *     ** * **         **    *  :
5hq0_A_1       6:MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGV-PSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQY: 104
SecStr          :GGGEEEEEEEEE SSEEEEEEEETTT  EEEEEEEE S STT S- HHHHHHHHHHTT  STTB  EEEEEE SSEEEEEEE  SEEHHHHHHHS TT  :    
ExpBur          :beebeeeeeeeeeebbebeebebeeeeeebbbbebebeeeeeee-bebbeebbebbeebeeebbbebebbbeeeeebbbbbeebeeebeeebeebeeeee:    
Contact         :         d    d  d            d d      bbbbb  b  bb bb  bb      d      b        ddddddd  d          

CDKL1_HUMAN   99:VPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLS: 198
                :    ****   * **   ***     *** ** * **     *** *** **    *   **  * * ****** * *   *  *** * **  ****  :
5hq0_A_1     105:MDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELAT: 204
SecStr          :  HHHHHHHHHHHHHHHHHHHTTTEE     GGGEEE TTS EEE   TT EETTEESS   TT S  TT  HHHHTT SS  THHHHHHHHHHHHHHHH:    
ExpBur          :beeeebbebbebbbebbbbbbeeebbbbbbbbebbebeeeeebbbbebbbbebeeeebeeeeeeeebbebbbbbbbbebeebeebbbbbbbbbbbbbbbb:    
Contact         :                 b  bbbb        dd d         dd     bb b      c                                     

CDKL1_HUMAN  199:GVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFP------------NISYPALGLLKGCLHMDPTQRLTCEQLLHHP: 286
                :  **  * *  ***  *   **            *        *  *        **            *     * **   *  **  *      * **:
5hq0_A_1     205:KKPLFHGDSEIDQLFRIFRALGT---------PNNEVW-----PEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP: 290
SecStr          :SS SS  SSHHHHHHHHHHHH  ---------  TTTS-----TTGGGSTT  TTS       SGGG  S  HHHHHHHHHHT SSTTTS  HHHHHTSG:    
ExpBur          :eeebbebeeeebbbeebbebbbb---------beeeeb-----eebeebeebeeebeeeeeeebeeebeebeeebbebbeebbebbeeebbebeebbebe:    
Contact         :       ccccc  c                                   c c cccccc                               bbb      

CDKL1_HUMAN  287:YFEN: 290
                :**  :
5hq0_A_1     291:YFND: 294
SecStr          :GG  :    
ExpBur          :bbee:    

MODEL[2] Protein B "CCNB1_HUMAN" TEMPLATE:5hq0_B_1 identity=98.9%
CCNB1_HUMAN  167:CSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEI: 266
                : ********************************************************************** ****************************:
5hq0_B_1       7:SSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNSVPKKMLQLVGVTAMFIASKYEEMYPPEI: 106
SecStr          :  TTHHHHHHHHHHHHHHT   TTTTTT SS HHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHTS   GGGHHHHHHHHHHHHHHHH SS   H:    
ExpBur          :eeeeeeeebeebeebbeebebeeebbeeeebebeebbebbbebbebbeeeebebbbbbbbbbbbbbbbbeeebeeeebebbbbbbbbbbbeeebeeebeb:    
Contact         :  aa  aa  aa                                                                          a   aaaa    aa

CCNB1_HUMAN  267:GDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQ: 366
                :*********************************************************************************** ****************:
5hq0_B_1     107:GDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFSLALKILDNGEWTPTLQ: 206
SecStr          :HHHHHHTTTSS HHHHHHHHHHHHHHTTT      HHHHHHHHHHHSS  HHHHHHHHHHHHHHTT GGGTTS HHHHHHHHHHHHHHHTT     HHHH:    
ExpBur          :eebbebbeeebeeeebeebbeebbeebeeebeebbbbebbeebbeeeeeeeebbbbbebbbbbbbbbbebbebeebbbbbbbbbbbbebbeeeebeeebe:    
Contact         :                a  aa   a  aa aaa    a                                                              

CCNB1_HUMAN  367:HYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAV: 430
                :****************************************************************:
5hq0_B_1     207:HYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAV: 270
SecStr          :HHH   HHHHHHHHHHHHHHHHHHHTT  S  HHHHHTTSGGGTTGGG GGGGSHHHHHHHH  :    
ExpBur          :eebebeeeebeebbbbbbbbbbebeeeeeeeebbeebbeeeebeebbebeebeeeebeebbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123