Protein Model on 1bk6 assembly_id=1 (TEMPLATE: 1bk6 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] KARYOPHERIN ALPHA :IMA1_YEAST
2 b B 1 (C) polymer(polypeptide(L)) [6 aa] LARGE T ANTIGEN 104L 105S 106R 108K(H) 110P 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 231W 235N 266E (identity: 95.0 %/49.6 %)
3 c C 1 (D) polymer(polypeptide(L)) [5 aa] LARGE T ANTIGEN 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1bk6_A_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1bk6_A_1       4:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 103
SecStr          :HHHHHT S HHHHHHHHHHHHHTTS SS   HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHHS HHHHH:    
ExpBur          :beeebeeeeeebbeebbebbbeebeeeeeeebeebbeeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebeb:    
Contact         :                       bbb b b                               b   b bbbb   b                         

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1bk6_A_1     104:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 198
SecStr          :HHHHHHHHHHHH HHHHHHHHHTT HHHHHHHT-----TS  HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHHS:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbebbeebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbeebbebbeeeeeebbbbbbebbbbbbe:    
Contact         :b  b   b  bb                                      b   b                              b              

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1bk6_A_1     199:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 298
SecStr          :S HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHHT HH:    
ExpBur          :eeeebbeebbeeebbeebbebbebeeeebbebbbebbbbbbebeeebbeebbebebbeebeebbebeeeebeebbbebbbebbeeeeebbeebbebebbe:    
Contact         :                                        ccc    c                            c  cc  c                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1bk6_A_1     299:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIIKMGEADKEARGLNINENADFIEKAGGMEKI: 398
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHHTTTT HHHHHHHHHTT HHHHHHHTTT  HHHHHHHHHHHHHHHHHHHHHHHHTT SS HHHHHHHHTTHHHHH:    
ExpBur          :ebbebbeebeeebbebbbebbbbbbebbeeeeebbeebbeeebbebbbebbeebeeebbebbbebbbebbebbeeebeeeeeeebebbeebbebebeeeb:    
Contact         :               c  c   c                                                                             

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
1bk6_A_1     399:FNCQQNENDKIYEKAYKIIETYF: 421
SecStr          :HHGGG S HHHHHHHHHHHHHH :    
ExpBur          :eebbebeeeebeebbebbbeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123