Protein Model on 1i7w assembly_id=1 (TEMPLATE: 1i7w assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [500 aa] BETA-CATENIN :CTNB1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [51 aa] EPITHELIAL-CADHERIN :CADH1_MOUSE 132D(N) 134S(K) 135P(F) 137Q(A) 141A(D) 149S(Y) 150G 155T(K) 179S(Y) 181Q(K) 184W 185A(T) 188N(R) 191G(K) 192D(V) 195V 197R(K) 231W 234S(R) 235N 241N(D) 277Y(N) 279T 280D(C) 281G(N) 286I(K) 311T(E) 312P 318G(R) 319N(H) 323G(R) 368D(R) 369Q(N) (identity: 21.2 %/27.9 %)
3 c C 1 (C) polymer(polypeptide(L)) [509 aa] BETA-CATENIN :CTNB1_MOUSE 171L(M) 172A(R) 173S(T) 177H(Y) 178I(T) 211A(L) 212L(H) 247D(E) 250E 251Q(G) 255T 283N(Y) 284E(K) 287G(M) 288M 291K(Q) 325D(Q) (identity: 17.6 %/27.9 %)
4 d D 1 (D) polymer(polypeptide(L)) [60 aa] EPITHELIAL-CADHERIN :CADH1_MOUSE
5 e E 1 (A) non-polymer(ZN) ZINC ION
6 f F 1 (A) non-polymer(CL) CHLORIDE ION 155T(K) (identity: 0.0 %/27.9 %)
7 g G 1 (A) non-polymer(CL) CHLORIDE ION 181Q(K) 184W 219S(R) (identity: 33.3 %/27.9 %)
8 h H 1 (A) non-polymer(CL) CHLORIDE ION 162G 164I(P) 165P(Q) (identity: 33.3 %/27.9 %)
9 i I 1 (A) non-polymer(CL) CHLORIDE ION 133C(V) 177H(Y) 178I(T) 179S(Y) (identity: 0.0 %/27.9 %)
10 j J 1 (C) non-polymer(ZN) ZINC ION
11 k K 1 (C) non-polymer(CL) CHLORIDE ION
12 l L 1 (C) non-polymer(CL) CHLORIDE ION
13 m M 1 (C) non-polymer(CL) CHLORIDE ION
14 n N 1 (C) non-polymer(CL) CHLORIDE ION 291K(Q) (identity: 0.0 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i7w_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1i7w_A_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :              bibb b   b       bb    b      h hh     ccc   ccb b  bb  b  bb  b    b             cc  
Contact         :                                     f                     iii g  g                                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1i7w_A_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT    HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeebeebeebbbbbbebbebeeeebbbbbbbbbbebbeebeebbeebbeeebbebbbebbeebeeebebbeb:    
Contact         :    g           b  bb     b     c  cc   c                     b bbb cc bcc  c                     bb
Contact         :                                                                            n                       

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
1i7w_A_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 416
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHHHHHHHHH  :    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebbeeebbebbbebbeebbeeeee:    
Contact         :     bb   b c                                              bb                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123