Protein Model on 1t08 assembly_id=1 (TEMPLATE: 1t08 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [510 aa] Beta-catenin :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [46 aa] Beta-catenin-interacting protein 1 :CNBP1_HUMAN
3 c C 1 (C) polymer(polypeptide(L)) [15 aa] Adenomatous polyposis coli protein :APC_HUMAN 149S(Y) 150G 155T(K) 191G(K) 192D(V) 195V 231W 234S(R) 235N 241N(D) 276S 277Y(N) 279T 280D(C) 281G(N) 286I(K) 311T(E) 312P 318G(R) 319N(H) 365G (identity: 38.1 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1t08_A_1 identity=27.4%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
1t08_A_1     131:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 226
SecStr          :TTHHHHHHHHTT   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbbbbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbbbbbebbebbbebeebbeebbebbbbebbbebbe:    
Contact         :                               cc    c                                   cc  c                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
1t08_A_1     227:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 318
SecStr          : S HH-----HHHHHHHHHHHH---HTT TT    HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeebeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbebbbeeebbebbbebbeebeeebebbeb:    
Contact         :                c  cc     c                                  cc ccc    c                          cc

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK--EAVW: 399
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   **       :
1t08_A_1     319:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRXXXXXX: 410
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHH ------:    
ExpBur          :bbbbbebbbbebeebeebbebbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebeeeebbebbbebbeebeeeeee------:    
Contact         :     cc                                                 c                                           

queryA       400:AVTNYTSGGTVEQIV: 414
                :       *   * **:
1t08_A_1     411:XXXQFVEGVRMEEIV: 425
SecStr          :---  SSS  HHHHH:    
ExpBur          :---eeeeebebeebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123