Protein Model on 1wa5 assembly_id=1 (TEMPLATE: 1wa5 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [170 aa] GTP-BINDING NUCLEAR PROTEIN RAN :RAN_KANFA 471D(E) 474E(F) 477Q 478N(Q) 479H(N) 485Y 489L(Y) 493E 498V(E) (identity: 33.3 %/47.3 %)
2 b A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [464 aa] IMPORTIN ALPHA SUBUNIT :IMA1_YEAST
3 c C 1 (C) polymer(polypeptide(L)) [938 aa] IMPORTIN ALPHA RE-EXPORTER :CSE1_YEAST 34V(Q) 35N(Q) 36V 37E 38L 39R 40K 42K 387S(E) 388K(V) 390D(E) 391F(Y) 409T(L) 410V(Q) 423E(K) 427N(D) 431A(I) 432K(A) 433D 434T(N) 435K(R) 438L(E) 457T(A) 459K(G) 460L 461S(N) 462I 465E 466E(K) 468G 472K 480E 481N 483S(K) 500E (identity: 42.9 %/47.3 %)
4 d D 1 (A) non-polymer(GTP) GUANOSINE-5'-TRIPHOSPHATE
5 e E 1 (A) non-polymer(MG) MAGNESIUM ION
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1wa5_B_1 identity=47.3%
queryA        26:EMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVN------WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG: 119
                :* ****    ******* *    ****                                       **     ** **   *  ****  ****  * **:
1wa5_B_1      31:ELRRRRDTQQVELRKAKRDEALAKRRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAG: 130
SecStr          :     TTSS    S     S  S     ----------------------------  HHHHHHHHS SSHHHHHHHHHHHHHHT  SSS SHHHHHHTT:    
ExpBur          :eebeebeeeeeeeeeeeeeeeeeeebbe----------------------------eeeeebbebbeeeeeeebeebbbbbbeebeeeeeeebeebbeee:    
Contact         :        ccccccc c                                                                                   

queryA       120:LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS: 219
                :  *  * *         * * ************ *** ***  * * ** **        *** ***** ***    ** *    *  * * *       :
1wa5_B_1     131:VVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----N: 225
SecStr          : HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHH  HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----G:    
ExpBur          :bbebbbebbeeebeeebbbbbbbbbbbbbbeeeebbeebbebebbebbbebbeebeeebebbbbbbbbbbbebeeebbeebbeeebbebbbebb-----e:    

queryA       220:SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN: 319
                :*      *  ********* * * *    * * ****  *    * * * * ******* *** * *  *        ** **        ****** **:
1wa5_B_1     226:SNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGN: 325
SecStr          :S  HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHHHSS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHH:    
ExpBur          :eeeeebbebbbbbbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbbbbbbbbbbeeebbebbbeeebbebbbebbebeeeebbbbbbbbbbb:    

queryA       320:IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLV: 417
                :**** * ****** ** *     **  ** ** *** ** ******   *** *    * * **  *  *  ** *** **  *  ***      * ***:
1wa5_B_1     326:IVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLV: 425
SecStr          :HTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHTTT THHHHHHH:    
ExpBur          :bbbbeeebbeebbeeebbebbeebbebeeeebbebbbbbbbbbbbbebebbebbbebebbeebbebbeebeeebeebbbbbbbbbbebbeeeeebbeebb:    
Contact         :                                                                   cc cc                 cc         

queryA       418:HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEE: 501
                :  * * **  **   *  ** * ***  **    *   *   * *      **  **  **   *  **   *      ** **  ** :
1wa5_B_1     426:SQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEED: 514
SecStr          :HTT HHHHHHHTTT  HHHHHHHHHHHHHHHHHHHHHHHHHT SS HHHHHHHHTTHHHHHHGGGG S HHHHHHHHHHHHHHSSS  -:    
ExpBur          :eeebbebbbebbeebeeebbbbbbebbbbbbebbeebeeeeeeeebebbeebeebebbebbeebbeeeeeebeeebeebbeebbeeee-:    
Contact         :     c   c   ccccc  c                  c cccc c  c  cc c  ac a  aaacc c a   a   a    a c            


Input Residue Numbers for Focused Sites

ex) 2,15,123