Protein Model on 2jdq assembly_id=1 (TEMPLATE: 2jdq assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN 345T(S) 380P 387S(Q) 414V(K) 415Y 417V 418H(E) 419C(L) 420G 423E(K) 462I 463M(L) 466E 467C(A) 470L (identity: 46.7 %/50.7 %)
2 b A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [426 aa] IMPORTIN ALPHA-1 SUBUNIT :IMA1_HUMAN
3 c C 1 (D) polymer(polypeptide(L)) [63 aa] POLYMERASE BASIC PROTEIN 2 :PB2_IAVI7 105S 107E 138F 142W 146N 148A 149S 150G 151T(N) 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 240K 273W 277Y 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 357W 360S 361N 364A 365G 366R(N) 367Q(R) 396E 399W 402T 403N 406S 407G 438L(Q) 442D(N) 498V(T) 499E 501E (identity: 88.0 %/50.7 %)
4 d D 1 (E) polymer(polypeptide(L)) [65 aa] POLYMERASE BASIC PROTEIN 2 :PB2_IAVI7
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2jdq_B_1 identity=50.7%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
2jdq_B_1      24:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 123
SecStr          :HHHHHHSSS HHHHHHHHHHHHHHTTSSS   HHHHHTSTT HHHHHHHTT TT HHHHHHHHHHHHHHHSS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :ebeeebebeeeeebbebbeebeeebeeeeeeebeebbebeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    
Contact         :                         c c                               c   c   c cccc   c                       

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
2jdq_B_1     124:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 219
SecStr          :HHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTTSS   HHHH----HHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeebebbeebbeeebbeebbebbeeeeeeebb----ebbbebbbbbbeeeeeebebeebeebbebbbebbeeebeebbbbbbebbbeb:    
Contact         :  c  c   c  cc                                   c  c   c  c c                                c   c 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
2jdq_B_1     220:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 319
SecStr          :TSS HHHHHHHHHTTTHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT :    
ExpBur          :beeeeebbeebbebebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbebbbebbbebbebeeebbeebbebeb:    
Contact         : cc c  c                            c   c ccc    c                a           c  cc  cccc           

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
2jdq_B_1     320:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 419
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHHHHHHTSS   HHHHHHHHHH HHHH:    
ExpBur          :beebbebbeebeeebbebbbebbbbbbeebbeebbeebbeeebbebbbebbebeeeebeebbeebbebbeebbeeebeeeeeeebebeeebeebbeeeeb:    
Contact         : a      a        c  c  cc  cc      aa aaaa  a              c   c                   a a  aa  aa  a   

queryA       474:EALQNHENESVYKASLSLIEKYFSVEEE: 501
                :* ** ***   *     *** **  * *:
2jdq_B_1     420:EFLQSHENQEIYQKAFDLIEHYFGTEDE: 447
SecStr          :HHHH HHHHHHHHHHHHHHHHHT     :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :                        cc c                                                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123