Protein Model on 4bqk assembly_id=1 (TEMPLATE: 4bqk assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [424 aa] IMPORTIN SUBUNIT ALPHA-1A :IMA1A_ORYSJ
2 b D 1 (D) polymer(polypeptide(L)) [14 aa] T-DNA BORDER ENDONUCLEASE VIRD2 :VIRD2_AGRT5 104L 105S 106R(I) 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 234S 235N 238R 270D 280D 315R 319N 321V 322T 323G 328T 353K 354E 357W 360S 361N 364A 396E 399W 403N 406S 407G (identity: 97.7 %/52.3 %)
3 c E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 168I(V) 169S(K) 171L 172A(G) 208P (identity: 40.0 %/52.3 %)
4 d F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 176A(D) 179S(R) 180E 216P(H) 217D(T) 218M(K) 221L(M) (identity: 14.3 %/52.3 %)
5 e G 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 213L 214A(N) 255T(A) 258R (identity: 50.0 %/52.3 %)
6 f H 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 250E(R) 253L 254P 288M(A) 291K(E) 292T(A) (identity: 33.3 %/52.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4bqk_A_1 identity=52.3%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*      *  *     ** **   ***** *  ***   *  *  * ** ** * *    *** ************* ** * * ** * *  ** *   :
4bqk_A_1       3:SLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSD: 102
SecStr          :THHHHHHHHHSS HHHHHHHHHHHHHHHT SSS  HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S H:    
ExpBur          :eeeebeebbebeeeeebbebbbebbeebeeeeeebbeebbebebbebbbebbebeebeebbebbbebbbbbbeeeeebbeebbeeebbeebbebbebebe:    
Contact         :                           bbbb  b                           b   b   b bbbbb  b            cc cc   d

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********* ***    ****   **  **** *      *     *** ****** ** * * *        ** * ** *  * *** * *** *:
4bqk_A_1     103:DVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSM----LRNATWTLSNFCRGK-PQPSFEQTRPALPALARLIHSNDEEVLTDACWALS: 197
SecStr          :HHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHT  TT  HHH----HHHHHHHHHHHH SS-S   HHHHTTHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbeeebeeeb----eebbbebbbbbbeee-eebebeebeebbebbbebbebebeebbebbbebbb:    
Contact         :  ddb  b   b  bb               c    ee ddd  d      b  b  bb  b           f  ffe  e           b      

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :** ** *  *  *   ** * ** **         ****  ****** * ***  **  **    **** * *  * *** ** ******  **** * *:
4bqk_A_1     198:YLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVIN: 297
SecStr          :HHTSSSHHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHHHS   HHHHHHHHHHHHHHHTS HHHHHHHHH:    
ExpBur          :bbbeeeeebbebbbeeebbebbbebbebebeebbebbbebbbbbbebeeebbeebbeeebbebbeebbeeeeeeebbebbbebbbebbebeeebbebbbe:    
Contact         :   b       f  ff                      b   b bbb    b                         bb  b  bb  b           

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEK---------LSIMIEE: 466
                : *    **  *  * *   *** **  * ****   ** ***  * * **  **   *  *  * *    **     * *** *          * ** *:
4bqk_A_1     298:AGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENIL----KVGETDKTLAAGDVNVFSQMIDE: 393
SecStr          :HT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHH----HHHHHHHHHTT S  HHHHHHHH:    
ExpBur          :eebbeebbebbeebeeebebbbbebbbbbbeebeeebbeebbeeebbebbbebbebebeebbbbbbebbbbbb----ebbeeeeeeeeeeebebbeebee:    
Contact         :                    b  b   b  bb                                                                    

queryA       467:CGGLDKIEALQNHENESVYKASLSLIEKYF: 496
                :  ** *** ** * *   *       * * :
4bqk_A_1     394:AEGLEKIENLQSHDNNEIYEKAVKILEAYW: 423
SecStr          :TTHHHHHHHHTT S HHHHHHHHHHHHHH :    
ExpBur          :bebbebbeebeeeebeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123