Protein Model on 4evt assembly_id=1 (TEMPLATE: 4evt assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [490 aa] Catenin beta-1 :CTNB1_MOUSE
2 b B 1 (A) non-polymer(URE) UREA 173S(T) 177H(Y) 178I(T) (identity: 0.0 %/27.9 %)
3 c C 1 (A) non-polymer(URE) UREA 178I(T) 180E 215V(D) (identity: 33.3 %/27.9 %)
4 d D 1 (A) non-polymer(URE) UREA
5 e E 1 (A) non-polymer(URE) UREA 128L 129G(N) 130R(K) 136I(L) 177H(Y) (identity: 20.0 %/27.9 %)
6 f F 1 (A) non-polymer(URE) UREA 131T 132D(N) 133C(V) (identity: 33.3 %/27.9 %)
7 g G 1 (A) non-polymer(URE) UREA 202K(E) 203Y(A) 204G 246I(Q) (identity: 25.0 %/27.9 %)
8 h H 1 (A) non-polymer(URE) UREA 195V (identity: 100.0 %/27.9 %)
9 i I 1 (A) non-polymer(URE) UREA 280D(C) 281G(N) 286I(K) 319N(H) 323G(R) (identity: 0.0 %/27.9 %)
10 j J 1 (A) non-polymer(URE) UREA
11 k K 1 (A) non-polymer(URE) UREA 211A(L) 214A(T) 215V(D) (identity: 0.0 %/27.9 %)
12 l L 1 (A) non-polymer(URE) UREA 172A(R) 211A(L) (identity: 0.0 %/27.9 %)
13 m M 1 (A) non-polymer(URE) UREA 296P(E) 300K(R) (identity: 0.0 %/27.9 %)
14 n N 1 (A) non-polymer(URE) UREA 218M(Q) 219S(R) 227R(Q) 231W (identity: 25.0 %/27.9 %)
15 o O 1 (A) non-polymer(URE) UREA 331V(R) 332I(L) 334A(Y) (identity: 0.0 %/27.9 %)
16 p P 1 (A) non-polymer(URE) UREA 332I(L) 333D(H) (identity: 0.0 %/27.9 %)
17 q Q 1 (A) non-polymer(URE) UREA 318G(R) 361N(K) (identity: 0.0 %/27.9 %)
18 r R 1 (A) non-polymer(URE) UREA
19 s S 1 (A) non-polymer(URE) UREA 357W 358T(P) (identity: 50.0 %/27.9 %)
20 t T 1 (A) non-polymer(URE) UREA 290V(C) 293G 294V(G) 295V(I) 296P(E) 333D(H) (identity: 16.7 %/27.9 %)
21 u U 1 (A) non-polymer(URE) UREA
22 v V 1 (A) non-polymer(URE) UREA
23 w W 1 (A) non-polymer(URE) UREA
24 x X 1 (A) non-polymer(URE) UREA 131T 132D(N) (identity: 50.0 %/27.9 %)
25 y Y 1 (A) non-polymer(URE) UREA 217D(S) 219S(R) (identity: 0.0 %/27.9 %)
26 z Z 1 (A) non-polymer(URE) UREA 191G(K) 231W 234S(R) (identity: 33.3 %/27.9 %)
27 1 AA 1 (A) non-polymer(URE) UREA 216P 217D(S) 218M(Q) 219S(R) (identity: 25.0 %/27.9 %)
28 2 BA 1 (A) non-polymer(URE) UREA 188N(R) 191G(K) 228N (identity: 33.3 %/27.9 %)
29 3 CA 1 (A) non-polymer(URE) UREA 195V 197R(K) 235N 241N(D) (identity: 50.0 %/27.9 %)
30 4 DA 1 (A) non-polymer(URE) UREA 245P(K) 246I(Q) 282P(N) 284E(K) 285R(N) (identity: 0.0 %/27.9 %)
31 5 EA 1 (A) non-polymer(URE) UREA 245P(K) 281G(N) 282P(N) 283N(Y) 284E(K) (identity: 0.0 %/27.9 %)
32 6 FA 1 (A) non-polymer(URE) UREA 210L(G) 211A(L) 251Q(G) 252I(L) 255T (identity: 20.0 %/27.9 %)
33 7 GA 1 (A) non-polymer(URE) UREA 214A(T) 255T 258R(Q) (identity: 33.3 %/27.9 %)
34 8 HA 1 (A) non-polymer(URE) UREA 258R(Q) 261H(G) 262H(S) (identity: 0.0 %/27.9 %)
35 9 IA 1 (A) non-polymer(URE) UREA 291K(Q) 292T(V) (identity: 0.0 %/27.9 %)
36 A JA 1 (A) non-polymer(URE) UREA 346N(P) 355A(S) 360S(I) (identity: 0.0 %/27.9 %)
37 B KA 1 (A) non-polymer(URE) UREA 388K(R) (identity: 0.0 %/27.9 %)
38 C LA 1 (A) non-polymer(URE) UREA 377G 380P (identity: 100.0 %/27.9 %)
39 D MA 1 (A) non-polymer(URE) UREA
40 E NA 1 (A) non-polymer(URE) UREA
41 F OA 1 (A) non-polymer(URE) UREA
42 G PA 1 (A) non-polymer(URE) UREA
43 H QA 1 (A) non-polymer(URE) UREA 305S(D) 306E(R) 307L(E) 308P(D) (identity: 0.0 %/27.9 %)
44 I RA 1 (A) non-polymer(URE) UREA 331V(R) 334A(Y) 335G 337L 338A(P) (identity: 40.0 %/27.9 %)
45 J SA 1 (A) non-polymer(URE) UREA 130R(K) 131T 132D(N) (identity: 33.3 %/27.9 %)
46 K TA 1 (A) non-polymer(URE) UREA 125V 126S(A) 161G(S) (identity: 33.3 %/27.9 %)
47 L UA 1 (A) non-polymer(URE) UREA 127F(L) 130R(K) (identity: 0.0 %/27.9 %)
48 M VA 1 (A) non-polymer(URE) UREA 173S(T) (identity: 0.0 %/27.9 %)
49 N WA 1 (A) non-polymer(URE) UREA 218M(Q) 259L 262H(S) 267V (identity: 50.0 %/27.9 %)
50 O XA 1 (A) non-polymer(URE) UREA 290V(C) 295V(I) 326E 329Q(A) (identity: 25.0 %/27.9 %)
51 P YA 1 (A) non-polymer(URE) UREA 280D(C) 281G(N) (identity: 0.0 %/27.9 %)
52 Q ZA 1 (A) non-polymer(URE) UREA 318G(R) 322T(S) 369Q(N) (identity: 0.0 %/27.9 %)
53 R AB 1 (A) non-polymer(URE) UREA 342S(K) 343L 345T(H) 346N(P) 347P 355A(S) (identity: 33.3 %/27.9 %)
54 S BB 1 (A) non-polymer(URE) UREA 347P 355A(S) 356T(H) (identity: 33.3 %/27.9 %)
55 T CB 1 (A) non-polymer(URE) UREA 356T(H) 357W (identity: 50.0 %/27.9 %)
56 U DB 1 (A) non-polymer(URE) UREA 153E 156K(L) (identity: 50.0 %/27.9 %)
57 V EB 1 (A) non-polymer(URE) UREA
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4evt_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
4evt_A_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbbbbbebbebbbebeebeeebbebbbbebbbebbe:    
Contact         :       KKLeeefff  e                U  U    K          lb   bb c       2  z   h    3    ggg     6k  k
Contact         :            Jxx                                        M   ec            2   3                  l  7
Contact         :            LJJ                                                                                 6   

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
4evt_A_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---HTT    SS HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beeeeebeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbbebbeeebbebbbebbeebeeebebbeb:    
Contact         :c1ynn       n2  n  z3     3   4g    66  6  7N 88    N            ii4544i   t99tttm   m      HHHH    
Contact         :k 11y           z             54        7  8   N                 P55 5     O    Ot                  
Contact         :   N1                                                             P                                 

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
4evt_A_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 416
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHH :    
ExpBur          :bbbbbebbbbebeebeebbbbbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebeeeebbeebbebbeebbeeeee:    
Contact         :     qi  Qi  O  OO  O oopoI II   RR RAR       ASss Aq       Q           rr C  C       B             
Contact         :     Q                IptI           RS       RTT                       C                           
Contact         :                                              S                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123