Protein Model on 4pls assembly_id=1 (TEMPLATE: 4pls assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description d(query A)
1 a A 1 (A) polymer(polypeptide(L)) [280 aa] Arm00010 305S(P) 306E(N) 307L(E) 308P(Q) 311T(Q) 333D(E) (identity: 0.0 %/39.5 %)
2 b B 1 (B) polymer(polypeptide(L)) [281 aa] Arm00010 131T(P) 132D(N) 133C(E) 134S(Q) 137Q 174P 175H(N) 176A(E) 177H(Q) 180E(Q) 216P 217D(N) 218M(E) 219S(Q) 227R(Q) 263D(P) 264D(N) 265P(E) 266E(Q) 269A(Q) 306E(N) 308P(Q) (identity: 13.6 %/39.5 %)
3 c C 1 (C) polymer(polypeptide(L)) [280 aa] Arm00010 241N 283N 284E 286I 287G(Q) 290V(I) 295V(L) 299V 302L 307L(E) 310V(L) 311T(Q) 314L 315R(W) 318G 319N 320I 321V(A) 322T(S) 324T(G) 325D(N) 327Q 328T(K) 330V(A) 331V 334A 339V(A) 340F(L) 343L 351I 354E 355A 358T(A) 361N(K) 362I (identity: 51.4 %/39.5 %)
4 d A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [280 aa] Arm00010
5 e E 1 (A) non-polymer(CA) CALCIUM ION
6 f F 1 (A) non-polymer(CA) CALCIUM ION 305S(P) 307L(E) (identity: 0.0 %/39.5 %)
7 g G 1 (A) non-polymer(CA) CALCIUM ION
8 h H 1 (A) non-polymer(CA) CALCIUM ION
9 i I 1 (A) non-polymer(CA) CALCIUM ION
10 j J 1 (B) non-polymer(CA) CALCIUM ION 263D(P) 265P(E) (identity: 0.0 %/39.5 %)
11 k K 1 (B) non-polymer(CA) CALCIUM ION 216P 218M(E) (identity: 50.0 %/39.5 %)
12 l L 1 (B) non-polymer(CA) CALCIUM ION 131T(P) 133C(E) (identity: 0.0 %/39.5 %)
13 m M 1 (B) non-polymer(CA) CALCIUM ION
14 n N 1 (B) non-polymer(ACT) ACETATE ION
15 o O 1 (B) non-polymer(CA) CALCIUM ION 174P 176A(E) (identity: 50.0 %/39.5 %)
16 p P 1 (C) non-polymer(ACT) ACETATE ION
ALIGNMENTS
MODEL[4] Protein A "queryA" TEMPLATE:4pls_D_1 identity=39.5%
queryA       112:IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLA: 211
                :*   * **  *  *  *        * *  * * *****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  :
4pls_D_1      36:IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQ: 134
SecStr          :HHHHHHTTHHHHHHHGGG S HHHHH-HHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :beebbeeebbeebbebbebeeeebbe-ebbebbbbbbeeeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbebbbeeebbeebbe:    
Contact         :                   bbbb  b                                    bbbb  b                               
Contact         :                   l l                                        o o                                   

queryA       212:LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI: 309
                :**  *         *    *** *     *    * **     ** ** **       *    *       * ** *  *   *  * ** **      *:
4pls_D_1     135:LLSSPNEQ-----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 227
SecStr          :HTT S HH-----HHHHHHHHHHHHTTS HHH--HHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :bbeeeeee-----bbbbbbebbbbbbebbeeb--bbbbbeeebbeebbebbebeeeebbbbbbebbbbbbebbeebbebbeeeebeebbeebeeeeeeeb:    
Contact         :    bbbb       b             c                       bbbb  b             cc cc  c    c   c  c  aaaa 
Contact         :    k k                                              j j                                       fbcb 
Contact         :                                                                                                 f  

queryA       310:VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI: 362
                :   **   ***  *  ** * *  ***      *   *   *****      *:
4pls_D_1     228:LQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKI: 280
SecStr          :HHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHGGG SSHHHHHHHHHHHHH :    
ExpBur          :eebbeebeebbeebeeeeeeeeeeeebeeebeeeeebeeeeeeeebeeebeeb:    
Contact         :ca  cc  ccccc cc cc cc ac    cc  c       c  cc  c  cc                                               
Contact         : c                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123