Protein Model on 4zdu assembly_id=1 (TEMPLATE: 4zdu assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [416 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [12 aa] Peptide from Nucleoprotein :NCAP_I34A1 240K 315R 319N 321V 322T 323G 325D 328T 353K 354E 357W 360S 361N 364A 365G 366R 396E 399W 403N 406S 407G (identity: 100.0 %/93.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4zdu_A_1 identity=93.1%
queryA        76:WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH: 175
                :*** ******** * * *************     ******************* *********************************************:
4zdu_A_1       6:WSVEDIVKGINSNNLESQLQATQAARKLLSXXXXXPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH: 105
SecStr          :  HHHHHHHHTSS HHHHHHHHHHHHHHH ----- HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG SS:    
ExpBur          :eebeebbebbeeeeeeebbebbebbbeebe-----eeeebeeeebbeebbebbeeeebeebbebbbebbbebbeeeeebbeebbeeebbebbbebbebee:    

queryA       176:AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI: 275
                :******************* ******* ** *********** * ************************* **************** ******* ****:
4zdu_A_1     106:AHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAI: 205
SecStr          :HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT  S GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT   HHHHHHHHHHH:    
ExpBur          :eebbebbbebbbebbeeebebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbbbbebb:    
Contact         :                                                                b                                   

queryA       276:SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :*********** **** ************ ************************ *********************************************:
4zdu_A_1     206:SYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN: 305
SecStr          :HHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHH:    
ExpBur          :bebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbeebbe:    
Contact         :                                       b   b bbb b  b                        bb  b  bb  bbb         

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA: 475
                :******** ************* ** **************************** ******* *************************************:
4zdu_A_1     306:HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA: 405
SecStr          :TT HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHTTTHHHHHHH:    
ExpBur          :eebbeebbebbeebeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebebeeebee:    
Contact         :                    b  b   b  bb                                                                    

queryA       476:LQNHENESVYKASLSLIEKYF: 496
                :** *********** ******:
4zdu_A_1     406:LQRHENESVYKASLNLIEKYF: 426
SecStr          :GGG S HHHHHHHHHHHHHH :    
ExpBur          :beeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123