Protein Model on 5ekg assembly_id=1 (TEMPLATE: 5ekg assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (B) polymer(polypeptide(L)) [5 aa] XPG2 peptide 280D 281G 283N 286I 319N 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N 406S 407G (identity: 100.0 %/94.4 %)
2 b B 1 (C) polymer(polypeptide(L)) [9 aa] XPG2 peptide 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R (identity: 100.0 %/94.4 %)
3 c A(IMA1_HUMAN) C 1 (A) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:5ekg_C_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
5ekg_C_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeeebeeeeeeebeebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    
Contact         :                                bbbb  b                           b   b   b bbbb   b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
5ekg_C_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHS  S GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHTTSS HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbeb:    
Contact         :         b  b   b  bb                                   b  b   b  b                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
5ekg_C_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHHT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbebbeeeeebbeebbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebebeebbebbbebbbebbeeeeebbe:    
Contact         :        aa a  a                                a aaa    a                            a  aa  a       

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
5ekg_C_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S SHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeebbbbebbebbbbbbeeeeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbeebeeeeeeeebbeebeeeebee:    
Contact         :                        a  a   a  aa                                                                

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
5ekg_C_1     453:KIEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHTTSSSS HHHHHHHHHHHHHH :    
ExpBur          :bbeebeeeeeeebbeebeebeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123