Protein Model on 5umz assembly_id=1 (TEMPLATE: 5umz assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (E) polymer(polypeptide(L)) [6 aa] TNRC6A 281G 283N 286I 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.4 %)
3 c C 1 (D) polymer(polypeptide(L)) [8 aa] TNRC6A 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 235N 238R 270D (identity: 100.0 %/94.4 %)
4 d D 1 (B) non-polymer(GOL) GLYCEROL 76W 80D (identity: 100.0 %/94.4 %)
5 e E 1 (B) non-polymer(GOL) GLYCEROL 371Q 374V 411E 412Q 415Y (identity: 100.0 %/94.4 %)
6 f F 1 (B) non-polymer(GOL) GLYCEROL 414V 418H 451A 456E 460L (identity: 100.0 %/94.4 %)
7 g G 1 (B) non-polymer(GOL) GLYCEROL 238R 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5umz_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
5umz_A_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHTSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbeebbebb:    
Contact         :    d   d                       cccc  c                           c   c   c ccccc  c                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
5umz_A_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T SSHHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTTSS HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbeb:    
Contact         :         c  c   c  cc                                      c   c  c                               c 
Contact         :                                                                  g                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
5umz_A_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeebbe:    
Contact         : g   g   b b  b                            b   b bbb    b                         b  b  bb  b      e

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
5umz_A_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeebebbe:    
Contact         :  e                     b  b   b       ee fe  f                                f    f   f           

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
5umz_A_1     453:KIEALQRHENESVYKASLNLIEKYFS: 478
SecStr          :HHHHHHT S HHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebbeebbebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123