Protein Model on 5w4g assembly_id=1 (TEMPLATE: 5w4g assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (A) polymer(polypeptide(L)) [13 aa] DNA polymerase lambda :DPOLL_HUMAN 105S 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.4 %)
3 c C 1 (B) non-polymer(SO4) SULFATE ION 347P 348K 349T (identity: 100.0 %/94.4 %)
4 d D 1 (B) non-polymer(SO4) SULFATE ION 352Q 388K (identity: 100.0 %/94.4 %)
5 e E 1 (B) non-polymer(SO4) SULFATE ION 101R 102K (identity: 100.0 %/94.4 %)
6 f F 1 (B) non-polymer(SO4) SULFATE ION 367Q 409T 410V (identity: 100.0 %/94.4 %)
7 g G 1 (B) non-polymer(GOL) GLYCEROL 371Q 374V 411E 412Q 415Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5w4g_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
5w4g_A_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHHH SS   HHHHHHTTHHHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeebeeeebbebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbebbbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    
Contact         :                             ee  b                                b   b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
5w4g_A_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbeb:    
Contact         :         b  b  bb  bb                                      b   b  b                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
5w4g_A_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbe:    
Contact         :                                                 bbb    b                  ccc  d    b  bb  b  f   g

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
5w4g_A_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebee:    
Contact         :  g             d       b  b   b     ffgg  g                                                        

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
5w4g_A_1     453:KIEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHHHHS SSHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebbeebbebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123