Protein Model on 6sa6 assembly_id=1 (TEMPLATE: 6sa6 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [395 aa] DARPin-Armadillo fusion A5
2 b B 1 (A) non-polymer(CL) CHLORIDE ION
3 c C 1 (A) non-polymer(CL) CHLORIDE ION
4 d D 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
5 e E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 323G 325D(N) 364A(S) (identity: 33.3 %/37.8 %)
6 f F 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
7 g G 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 254P(A) (identity: 0.0 %/37.8 %)
8 h H 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 418H(D) 419C(A) 420G (identity: 33.3 %/37.8 %)
9 i I 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL
10 j J 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 449Q(S) 450A(G) 459K (identity: 33.3 %/37.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6sa6_A_1 identity=37.8%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :*  **  *   *        *       * * **  *   *  * ** **      *   **   ***  *  ** * *******     **  *   * :
6sa6_A_1     159:LAALVLKLNANDDQIIQEALWKLGNHASGGNLRIQWVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQIL: 258
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTTTHHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHH:    
ExpBur          :beebbeebebeeeeebeebbeebbebbeeeeeebeebbebebbebbbebbebeeeebbbebbebbbbbbebeeeebebbbeeebbebbeebbebeeeebb:    
Contact         : g                                                                    e e                           

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : ** **  **  *   *** *   *  * **  **        ** *   *  ***  ***      *    *  **      *    *    **     :
6sa6_A_1     259:QEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG--: 355
SecStr          :HHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS--:    
ExpBur          :ebbbebbbbbbebbeebbebbbeeebbebbeebbebebeebbbbbbebbbbbbebee-ebbbbbbeeebbebbbebbebeeeebbeebbebbbbbbeb--:    
Contact         :           e                                                     hhh                            jj  

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  *   *      * * * * * ** ****   *      **  *:
6sa6_A_1     356:--GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 396
SecStr          :-- HHHHHH--HHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHH :    
ExpBur          :--beebbeb--beeeebeebbeebeebeeeebeebbeebbeebee:    
Contact         :      j                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123