Protein Model on 1ee4 assembly_id=2 (TEMPLATE: 1ee4 assembly_id:2 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (B) polymer(polypeptide(L)) [423 aa] KARYOPHERIN ALPHA :IMA1_YEAST
2 b E 1 (E) polymer(polypeptide(L)) [9 aa] MYC PROTO-ONCOGENE PROTEIN :MYC_HUMAN 105S 106R 142W 146N 148A 149S 150G 151T 155T 180E 181Q 184W 187G 188N 191G 192D 231W 235N 238R 270D 273W (identity: 100.0 %/49.6 %)
3 c F 1 (F) polymer(polypeptide(L)) [4 aa] MYC PROTO-ONCOGENE PROTEIN :MYC_HUMAN 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W (identity: 100.0 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1ee4_D_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1ee4_D_1       6:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 105
SecStr          :HHHHHTSS HHHHHHHHHHHHHHH  SSS  HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHHHHS HHHHH:    
ExpBur          :bbeebeeeeeebbeebbeebbeebeeeeeeebeebbeeebbebbbebbbeebeeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbeebeeebeb:    
Contact         :                        bb                                   b   b bbbb   b                        b

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1ee4_D_1     106:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 200
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----GS  HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHHS:    
ExpBur          :bbbebbbbbbebeeebbbebbebebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbeebbebbeeeeeebbbebbebbbbbbe:    
Contact         :b  b  bb  bb                                      b   b  b                               b  b       

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1ee4_D_1     201:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 300
SecStr          :S HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbeebbebbeeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbeebbebeebebebbbbbbbbebbeeeeebbebbbebebbe:    
Contact         :                                        ccc    c                            c  cc  c                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1ee4_D_1     301:PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 400
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHGGGGT THHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHHTT S  HHHHHHHHTTHHHHH:    
ExpBur          :ebbebbeebeeebeebbbebbbbbbebbeebeebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeebeeeeeeebebbeebeeeebeebb:    
Contact         :               c  c                                                                                 

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
1ee4_D_1     401:FNCQQNENDKIYEKAYKIIETYF: 423
SecStr          :HHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :eebeeeeeeebeebbeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123