Protein Model on 4eva assembly_id=2 (TEMPLATE: 4eva assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (C) polymer(polypeptide(L)) [488 aa] Catenin beta-1 :CTNB1_MOUSE
2 b OA 1 (C) non-polymer(URE) UREA 133C(V) 134S(K) 179S(Y) (identity: 0.0 %/27.9 %)
3 c PA 1 (C) non-polymer(URE) UREA 131T 132D(N) (identity: 50.0 %/27.9 %)
4 d QA 1 (C) non-polymer(URE) UREA 178I(T) 180E 215V(D) (identity: 33.3 %/27.9 %)
5 e RA 1 (C) non-polymer(URE) UREA
6 f SA 1 (C) non-polymer(URE) UREA 128L 129G(N) 130R(K) 136I(L) 177H(Y) (identity: 20.0 %/27.9 %)
7 g TA 1 (C) non-polymer(URE) UREA 131T 132D(N) 133C(V) (identity: 33.3 %/27.9 %)
8 h UA 1 (C) non-polymer(URE) UREA 201I(V) 202K(E) 203Y(A) 204G 207D(Q) 246I(Q) (identity: 16.7 %/27.9 %)
9 i VA 1 (C) non-polymer(URE) UREA 195V (identity: 100.0 %/27.9 %)
10 j WA 1 (C) non-polymer(URE) UREA 280D(C) 281G(N) 286I(K) 319N(H) 322T(S) 323G(R) (identity: 0.0 %/27.9 %)
11 k XA 1 (C) non-polymer(URE) UREA
12 l YA 1 (C) non-polymer(URE) UREA
13 m ZA 1 (C) non-polymer(URE) UREA
14 n AB 1 (C) non-polymer(URE) UREA 165P(Q) 169S(N) 172A(R) (identity: 0.0 %/27.9 %)
15 o BB 1 (C) non-polymer(URE) UREA 194S 195V 196F(C) 197R(K) (identity: 50.0 %/27.9 %)
16 p CB 1 (C) non-polymer(URE) UREA 211A(L) 214A(T) 215V(D) (identity: 0.0 %/27.9 %)
17 q DB 1 (C) non-polymer(URE) UREA 218M(Q) 262H(S) 264D 267V (identity: 50.0 %/27.9 %)
18 r EB 1 (C) non-polymer(URE) UREA 216P 217D(S) 218M(Q) (identity: 33.3 %/27.9 %)
19 s FB 1 (C) non-polymer(URE) UREA 250E 288M 291K(Q) 292T(V) (identity: 50.0 %/27.9 %)
20 t GB 1 (C) non-polymer(URE) UREA 338A(P) 342S(K) (identity: 0.0 %/27.9 %)
21 u HB 1 (C) non-polymer(URE) UREA 388K(R) (identity: 0.0 %/27.9 %)
22 v IB 1 (C) non-polymer(URE) UREA 356T(H) 357W 358T(P) (identity: 33.3 %/27.9 %)
23 w JB 1 (C) non-polymer(URE) UREA 315R(C) 318G(R) (identity: 0.0 %/27.9 %)
24 x KB 1 (C) non-polymer(URE) UREA 323G(R) (identity: 0.0 %/27.9 %)
25 y LB 1 (C) non-polymer(URE) UREA
26 z MB 1 (C) non-polymer(URE) UREA 395K(R) (identity: 0.0 %/27.9 %)
27 1 NB 1 (C) non-polymer(URE) UREA 392K(D) 395K(R) (identity: 0.0 %/27.9 %)
28 2 OB 1 (C) non-polymer(URE) UREA 390D(H) 394Q (identity: 50.0 %/27.9 %)
29 3 PB 1 (C) non-polymer(URE) UREA
30 4 QB 1 (C) non-polymer(URE) UREA
31 5 RB 1 (C) non-polymer(URE) UREA
32 6 SB 1 (C) non-polymer(URE) UREA 368D(R) (identity: 0.0 %/27.9 %)
33 7 TB 1 (C) non-polymer(URE) UREA
34 8 UB 1 (C) non-polymer(URE) UREA
35 9 VB 1 (C) non-polymer(URE) UREA
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4eva_B_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
4eva_B_1     143:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 238
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHHH---   HHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTT:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeebeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebeeebbebbbbebbbebbe:    
Contact         :          fffccbb f                            n   n  n    fdbd             oioo  o   hhhh  h   p  p
Contact         :             ggg                                                             o                      

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
4eva_B_1     239:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 330
SecStr          : S HH-----HHHHHHHHHHHH---TTT    SS HHHHHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beeeeebeebeebbeebbebbeeeeeebbbbbbbbbbebbeebeebbbbbbeeebbebbbebbeebeeeeebbeb:    
Contact         :drrq                           h   s           q q  q            jj    j s  ss                      
Contact         :p  r                                                                                                

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
4eva_B_1     331:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 416
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSTT-------  HHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHHHHHHHHHH :    
ExpBur          :bbbbbebbbbebeebeebbbbbeeeeb-bebbbebbeee-------beeebbebbbebbebbbebeebbeebeeeebbeebbebbeebbeeeee:    
Contact         :  w  wj  jj                  t   t             vvv         6            yyt           u 2 1 2z      
Contact         :          x                                                                                  1      


Input Residue Numbers for Focused Sites

ex) 2,15,123