Protein Model on 1p9m assembly_id=1 (TEMPLATE: 1p9m assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (A) polymer(polypeptide(L)) [298 aa] Interleukin-6 receptor beta chain :IL6RB_HUMAN 47L 52R 55K 56Q 59Y 62D 138E 141R 142A 145M 152Q 153F (identity: 100.0 %/98.2 %)
2 b A 2 (A) polymer(polypeptide(L)) [298 aa] Interleukin-6 receptor beta chain :IL6RB_HUMAN 83E 84A 85L 86A 87E 88N 89N 90L 178K 182Q 183N 185W 186L 189M (identity: 100.0 %/98.2 %)
3 c A(IL6_HUMAN) B 1 (B) polymer(polypeptide(L)) [163 aa] Interleukin-6 :IL6_HUMAN
4 d B 2 (B) polymer(polypeptide(L)) [163 aa] Interleukin-6 :IL6_HUMAN
5 e C 1 (C) polymer(polypeptide(L)) [201 aa] Interleukin-6 receptor alpha chain :IL6RA_HUMAN 58R 61L 82K 97E 101C 102F 103Q 203Q 206L 207R 208A 210R 211Q (identity: 100.0 %/98.2 %)
6 f C 2 (C) polymer(polypeptide(L)) [201 aa] Interleukin-6 receptor alpha chain :IL6RA_HUMAN
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:1p9m_B_1 identity=98.2%
queryA        47:LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 146
                :****************************   *********************************************************************:
1p9m_B_1      21:LTSSERIDKQIRYILDGISALRKETCNKXXXCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 120
SecStr          :  TTHHHHTHHHHHHHHHHHHHHHHTT ---  S      S         GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHTTS STTHHHHHHHHHH:    
ExpBur          :eeeeeebeeebeebeebbebbeebbbee---eeeeeeeeeeeeeebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbeebeebeeebebbbeb:    
Contact         :a    a  aa ea ea                   ebbbbbbbb      e   eee                                  a  aa  a 

queryA       147:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :******************************************************************:
1p9m_B_1     121:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHSSTTT S     TTHHHHHHHHHTSS HHHHHHHHHHHHHHHHHHHHHHHHHHH  :    
ExpBur          :beebbeebbeebeeeeeeeeeeeeeeeeeeeebeeeeeeebeebbbebbebbeebbeebbebbeee:    
Contact         :     aa                        b   bb bb  b             e  eee ee                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123