#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmf assembly_id=1

Protein Model on 4wmf assembly_id=1 (TEMPLATE: 4wmf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3547S 3548A(T) 3549L(M) 3562Q 3563C(I) 3564S(M) (identity: 66.7 %/51.8 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [303 aa] MERS-CoV 3CL protease :W6A941_9BETC
3 c C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
6 f F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
7 g G 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 3304H 3312M(L) 3403F 3404L 3405N(C) 3407S 3426H 3427H(Q) 3428M 3429E 3451R(K) 3452Q (identity: 66.7 %/51.8 %)
8 h H 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 3381Y 3386S(T) (identity: 50.0 %/51.8 %)
9 i I 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3394R 3460D 3461T(K) 3462T(Y) 3501N(Q) (identity: 40.0 %/51.8 %)
10 j J 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3364Y 3365K(T) 3366F (identity: 66.7 %/51.8 %)
11 k K 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 3429E 3430L 3452Q 3453T(V) 3454A(H) (identity: 60.0 %/51.8 %)
12 l L 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL 3269M 3270A(S) 3271F(H) 3561R(M) (identity: 25.0 %/51.8 %)
13 m M 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
14 n N 1 (C) non-polymer(PG4) TETRAETHYLENE GLYCOL
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4wmf_B_1 identity=51.8%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmf_B_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeeeeebebeebeeebeeeebebebeeeeeeebebebeeeeebbbebebeeebee:    
Contact         :aa aaaaaaaa  a                          g       g                                                   
Contact         :     lll                                                                                            

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmf_B_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :   jjj              h   aaaaa    i     aaaaag g                  gggak aa a               ggkk     i
Contact         :                         h                gg                        g                      k        
Contact         :                                                                    k                               

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmf_B_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeeebee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :ii              a                       i                                             aaaa          

queryA      3560:VRQCSGV:3566
                :  *  **:
4wmf_B_1     297:NMQIMGV: 303
SecStr          :HHHHS  :    
ExpBur          :bebebee:    
Contact         : laaa                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123