#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5rgy assembly_id=1

Protein Model on 5rgy assembly_id=1 (TEMPLATE: 5rgy assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2 3264S 3265G 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3543T 3546G 3548A 3549L 3553E 3562Q 3564S 3565G 3566V 3567T (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(UGS) N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)acetamide
4 d B 2 (A) non-polymer(UGS) N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)acetamide 3312M 3427H 3428M 3429E 3430L 3431P 3452Q 3453T 3454A (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3337Q 3338L 3339R (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3386S (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3269M 3270A 3271F 3390Q 3558D 3561R (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3277E 3278G 3280M 3281V 3333A (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3264S (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3403F 3404L 3405N 3407S 3426H 3428M 3429E (identity: 100.0 %/100.0 %)
13 m G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
14 n G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3459T 3461T 3503E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5rgy_A_2 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
5rgy_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  aj jj                              d                    j   fff                        
Contact         :k    hhh     j                                                                                      

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
5rgy_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebbb:    
Contact         :                 a  aaaaaaa         aaaaal l                  lddadd   a                ddd    n n  
Contact         :                      g   h            ll                       ld                                  
Contact         :                                                                 l                                  

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
5rgy_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebeeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                       n                                       a  a aa   a    h  ha 

queryA      3564:SGVT:3567
                :****:
5rgy_A_2     301:SGVT: 304
SecStr          :TT  :    
ExpBur          :eeee:    
Contact         :aaaa                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123