#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wtk assembly_id=1

Protein Model on 6wtk assembly_id=1 (TEMPLATE: 6wtk assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_SARS2 3264S 3265G 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3543T 3546G 3548A 3549L 3562Q 3563C 3564S 3565G 3566V 3567T 3568F 3569Q (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(UED) N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}-L-leucinamide 3290L 3304H 3312M 3317Y 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3435H 3450D 3452Q (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(UED) N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}-L-leucinamide
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wtk_A_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
6wtk_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bbbbbbbbbbb  b            c             c       c    c                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
6wtk_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbebebeebbbbbbbbbbeeebbbbbbbbbbebeeeebbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                 b  bbbbbbbb        bbbbbcccc                 cccb     b              c c           
Contact         :                                       cc                        c     c                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
6wtk_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebebeeebeeeebeebbeeeebbebeeebbeebeebbeeeeeebeebbbbbbebbeeebeeeebeebeeeebbbbbebbebbe:    
Contact         :                                                                               b  b bb            bb

queryA      3564:SGVTFQ:3569
                :******:
6wtk_A_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :bbbbbb                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123