#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yz6 assembly_id=1

Protein Model on 6yz6 assembly_id=1 (TEMPLATE: 6yz6 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] Main Protease :R1AB_SARS2 3264S 3265G 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3546G 3548A 3549L 3561R 3562Q 3563C 3564S 3565G 3566V 3567T (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] Main Protease :R1AB_SARS2
3 c B 1 (C) polymer(polypeptide(L)) [4 aa] LEUPEPTIN
4 d B 2 (C) polymer(polypeptide(L)) [4 aa] LEUPEPTIN 3304H 3312M 3317Y 3405N 3406G 3407S 3408C 3427H 3428M 3429E 3450D 3451R 3452Q 3453T (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3485R 3486F 3487T 3526D (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3300Y 3364Y 3366F (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(IMD) IMIDAZOLE
10 j E 2 (A) non-polymer(IMD) IMIDAZOLE 3327H 3328N 3330L (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3277E 3278G 3280M 3281V 3334G 3360K (identity: 100.0 %/100.0 %)
13 m G 1 (A) non-polymer(CL) CHLORIDE ION 3547S 3548A 3549L (identity: 100.0 %/100.0 %)
14 n G 2 (A) non-polymer(CL) CHLORIDE ION 3547S 3548A 3549L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6yz6_A_2 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
6yz6_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeeebbbbbbbbbeeebeeebebeebbeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  al ll                  h   d       d    d         jj j   l                         l   
Contact         :             l                                                                                      

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
6yz6_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeebbbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeeebb:    
Contact         :h h              a  aaaaaaaa        aaaaadddd                  dda     a              dddd          
Contact         :                                                                 d                                  

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
6yz6_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebeebeebbbbbbbebbebbe:    
Contact         :                     fff                                      f                   amaa           aaa
Contact         :                                                                                   nmm              
Contact         :                                                                                    nn              

queryA      3564:SGVT:3567
                :****:
6yz6_A_2     301:SGVT: 304
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :aaaa                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123