#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7buy assembly_id=1

Protein Model on 7buy assembly_id=1 (TEMPLATE: 7buy assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] SARS-CoV-2 virus Main protease
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] SARS-CoV-2 virus Main protease 3264S 3265G 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3543T 3546G 3548A 3549L 3553E 3561R 3562Q 3564S 3565G (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(JRY) hexylcarbamic acid 3304H 3312M 3406G 3407S 3408C 3427H 3428M 3450D (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(JRY) hexylcarbamic acid
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3403F 3404L 3405N 3407S 3426H 3428M 3429E 3435H (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3278G 3279C 3280M 3281V 3294W 3334G 3360K (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3265G 3266F 3267R 3545L (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3400K 3401G (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3429E 3430L 3451R 3452Q 3453T 3455Q (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3269M 3270A 3271F 3390Q 3561R (identity: 100.0 %/100.0 %)
14 n G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3386S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7buy_A_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
7buy_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHHS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bbibbbbbbbb  bgggg            g         c       c                     g                         g   
Contact         : i i mmm                                                                                            

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
7buy_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEESSSEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :                     bbbbbbb        bbbbbeccc                 eccbk    b              ckkk k        
Contact         :                      n   m         jj ee  e                    ee     e                            
Contact         :                                                                 k                                  

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
7buy_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbbeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeeb:    
Contact         :                                                                               b ib bb   b       bb 
Contact         :                                                                                                 m  

queryA      3564:SGVTFQ:3569
                :******:
7buy_A_1     301:SGVTFQ: 306
SecStr          : S    :    
ExpBur          :eeeeee:    
Contact         :bb                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123