#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wuu assembly_id=4

Protein Model on 6wuu assembly_id=4 (TEMPLATE: 6wuu assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [318 aa] papain-like protease :R1AB_SARS2
2 b H 1 (J) polymer(polypeptide(L)) [5 aa] VIR250 1672N 1674C 1675Y 1725L 1726G 1727D 1771M 1810P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 100.0 %/99.7 %)
3 c N 1 (D) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/99.7 %)
4 d O 1 (D) non-polymer(MG) MAGNESIUM ION 1677A 1836Y 1848I 1849D 1850G (identity: 100.0 %/99.7 %)
5 e P 1 (D) non-polymer(MG) MAGNESIUM ION 1582Q 1624D (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wuu_D_1 identity=99.7%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
6wuu_D_1       3:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 102
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHTSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   THHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebebeebbeeebeebbbeeeebbeeebeeebeeeebebeeeeeebeebbeebbeeeeeebbebbbebbeebeebebeebee:    
Contact         :                  e                                         e                                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
6wuu_D_1     103:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 202
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeeeebeebbeebbeebebeebebbbbeebeeeeeeeeebe:    
Contact         :        b bb d                                               bbb                        c  c        

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
6wuu_D_1     203:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 302
SecStr          :GGGGTEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :eeebbbbeebbebeebbebbeeeeeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebbb:    
Contact         :       b               c c                    bb               b   bbbbbb           ddd             
Contact         :                                                                        d                           

queryA      1864:TDVFYKENSYTTTIKPV:1880
                :**************** :
6wuu_D_1     303:TDVFYKENSYTTTIKPL: 319
SecStr          :EEEEEE S EE      :    
ExpBur          :bbbbbebeebebeeeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123