Protein Model on 2ynb assembly_id=1 (TEMPLATE: 2ynb assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-LIKE PROTEINASE :R1A_BCHK4
2 b B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-LIKE PROTEINASE :R1A_BCHK4 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3384S(K) 3385P 3386S(T) 3387G 3388V 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3548A(S) 3549L(T) 3561R(M) 3562Q (identity: 71.0 %/51.0 %)
3 c C 1 (A) non-polymer(NI) NICKEL (II) ION 3290L 3304H 3408C (identity: 100.0 %/51.0 %)
4 d D 1 (A) non-polymer(NI) NICKEL (II) ION 3405N(C) (identity: 0.0 %/51.0 %)
5 e E 1 (B) non-polymer(G85) N-[(benzyloxy)carbonyl]-O-tert-butyl-L-seryl-N-{(2R)-5-ethoxy-5-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]pentan-2-yl}-L-phenylalaninamide
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ynb_A_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
2ynb_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TT  SS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeeeeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b            c             c                                                           

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
2ynb_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebebeeeebbbbbebebbeeebeeebbbbbbbeeeeeebebbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                       bbbbbb          bbbbbd  c                    b  bb b                         

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
2ynb_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :                b                                                                     b bb          

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
2ynb_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHHH      :    
ExpBur          :beebeeeeee:    
Contact         : bb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123