Protein Model on 4ow0 assembly_id=1 (TEMPLATE: 4ow0 assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [312 aa] papain-like protease :R1A_CVHSA
2 b C 1 (A) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/82.4 %)
3 c D 1 (A) non-polymer(S88) N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-ylethyl]piperidine-4-carboxamide 1725L 1726G 1727D 1810P 1811P 1827Y 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/82.4 %)
4 d E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1720K 1725L 1730E 1831Y (identity: 100.0 %/82.4 %)
5 e F 1 (A) non-polymer(GOL) GLYCEROL 1748L 1760T 1795K(Q) (identity: 66.7 %/82.4 %)
6 f G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 1687E 1740N 1744C(A) 1802S 1803P(S) (identity: 60.0 %/82.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ow0_A_1 identity=82.4%
queryA      1566:RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLT:1665
                : ********** ***** ***************************  ****** *** ***** ******** * ***************** *** ***:
4ow0_A_1       4:KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLT: 103
SecStr          : EEEEEEESSSSS EEEEEESSS SHHHHSSEESSS  GGGS   SS TT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE:    
ExpBur          :eebebebbbbeeeebeeebeeeebbeeebeebbeebeebeeeebeeebeeebbbbebeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeebb:    

queryA      1666:SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGV:1765
                :******** **   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** **:
4ow0_A_1     104:SIKWADNNUYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGV: 203
SecStr          :     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTBS TT EEEEEEE SSS EEEEEEETH:    
ExpBur          :bbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeebebeebbeebbebbebeebebbbeeebeeeeeeeeebeee:    
Contact         :                     f                                d    ccc  d         f   f   e   b  b    e     
Contact         :                                                           d                                        

queryA      1766:EAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD:1865
                :***********   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** **:
4ow0_A_1     204:EAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD: 303
SecStr          :HHHEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESEEEEEEEE:    
ExpBur          :ebbbbeebbbbeebbebbeeebeeeeebebbbbebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeeebbebebeeeeebeebebebbb:    
Contact         :                     b b     e      ff      cc               c   cc   c                           c 
Contact         :                                                                 d                                  

queryA      1866:VFYKENSYTTTI:1877
                :***** ******:
4ow0_A_1     304:VFYKETSYTTTI: 315
SecStr          :EEEE SEEE   :    
ExpBur          :bbbebeebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123