Protein Model on 4yo9 assembly_id=1 (TEMPLATE: 4yo9 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3415I(E) 3429E 3432T(N) 3433G 3435H 3477N 3547S(Q) 3548A(S) 3562Q (identity: 72.4 %/51.2 %)
2 b A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_BCHK4
3 c C 1 (A) non-polymer(ZN) ZINC ION
4 d D 1 (A) non-polymer(ACT) ACETATE ION
5 e E 1 (A) non-polymer(ACT) ACETATE ION 3269M 3561R(M) 3562Q (identity: 66.7 %/51.2 %)
6 f F 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 3270A(S) 3561R(M) (identity: 0.0 %/51.2 %)
7 g G 1 (A) non-polymer(SIN) SUCCINIC ACID 3274G 3277E 3278G(N) 3333A(G) (identity: 50.0 %/51.2 %)
8 h H 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL
9 i I 1 (B) non-polymer(ACT) ACETATE ION 3394R 3460D 3461T(K) 3462T(Y) (identity: 50.0 %/51.2 %)
10 j J 1 (B) non-polymer(ACT) ACETATE ION 3560V(N) 3561R(M) (identity: 0.0 %/51.2 %)
11 k K 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL 3368R(T) 3441E(D) (identity: 0.0 %/51.2 %)
12 l L 1 (B) non-polymer(IPA) ISOPROPYL ALCOHOL 3269M 3374T(S) 3375F 3376S 3390Q(T) 3413F(Y) 3414N(T) 3558D (identity: 50.0 %/51.2 %)
13 m M 1 (B) non-polymer(FMT) FORMIC ACID 3325S(T) 3326N 3327H (identity: 66.7 %/51.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:4yo9_B_1 identity=51.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yo9_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGS  SS  SS  HHHHHHHS GGG EEEB SSS B   EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeebeeeebeeebeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :aa aaaa aaa  ag                                              mmm        g                           
Contact         :     ef   g  g                                                                                      
Contact         :     l                                                                                              

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yo9_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEEETTEEEEEEEEEEE SSS EEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeee:    
Contact         :       k     lll        aaaaal   i     aaaaa        lla             a  aa a     k                  i

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yo9_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHH-HHS  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebbbebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :ii              a                                                                      aa         l 

queryA      3560:VRQ:3562
                :  *:
4yo9_B_1     297:NMQ: 299
SecStr          :HHH:    
ExpBur          :beb:    
Contact         :jea                                                                                                 
Contact         : fe                                                                                                 
Contact         : j                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123