Protein Model on 4wmf assembly_id=2 (TEMPLATE: 4wmf assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description c(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 3473A 3476I(L) 3477N 3562Q 3563C(I) 3565G 3566V 3567T(V) 3568F(M) 3569Q (identity: 60.0 %/51.0 %)
2 b B 1 (B) polymer(polypeptide(L)) [303 aa] MERS-CoV 3CL protease :W6A941_9BETC
3 c A(R1A_SARS2) C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC
4 d D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
5 e E 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
6 f F 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
7 g G 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
8 h H 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
9 i I 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
10 j J 1 (B) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
11 k K 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
12 l L 1 (B) non-polymer(PG4) TETRAETHYLENE GLYCOL
13 m M 1 (C) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3364Y 3365K(T) 3366F (identity: 66.7 %/51.0 %)
14 n N 1 (C) non-polymer(PG4) TETRAETHYLENE GLYCOL 3298V(T) 3300Y(W) 3346Q 3351K (identity: 50.0 %/51.0 %)
ALIGNMENTS
MODEL[3] Protein A "queryA" TEMPLATE:4wmf_C_1 identity=51.0%
queryA      3274:GKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQ:3370
                :* ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** ** * *    :
4wmf_C_1      11:GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADXXXDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVK: 110
SecStr          : TTGGGEEEEEETTEEEEEEEETTEEEEEGGGGS   ---   HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT  SEEE    :    
ExpBur          :eebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeee---ebebeebeeebeeeebebebbeeeeeebebeeeeeeebbbebebeeebeebbeeeeeebe:    
Contact         :                        n n                                                n    n            mmm    

queryA      3371:PGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAW:3470
                :**  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *      **    *** **:
4wmf_C_1     111:PGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAXGTHTGSAFDGTMYGAFMDKQVXXXQLTDKYCSVNVVAW: 210
SecStr          :TT EEEEEEEETTEEEEEEEEEB TTS EE    TT TT EEEEEETTEEEEEEEEEEE  - EEEEE TTS BGGG   S  ---    SB HHHHHHH:    
ExpBur          :eeeebebbbbbebeebbebebebeeeebbebbbbeebbbbbbbeeeeeebebbbbbbbeee-ebbbbbbbebebbeeeebbee---eeeeebebbbbbbb:    

queryA      3471:LYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ:3569
                :****  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **  *  **  *:
4wmf_C_1     211:LYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ: 306
SecStr          :HHHHHHHT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS      HHHHHHHHHT    :    
ExpBur          :bbbbbeeebeebeeeeebeeeebbeebeeebbeebeeeebbee---bbeebebbbebbbebbbebb-ebbeeeebeebbbbbeeeebeebbeeeeeeeee:    
Contact         :  a  aa                                                                                     aa aaaaa


Input Residue Numbers for Focused Sites

ex) 2,15,123