#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1q2w assembly_id=1

Protein Model on 1q2w assembly_id=1 (TEMPLATE: 1q2w assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [295 aa] 3C-like protease :R1A_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [297 aa] 3C-like protease :R1A_CVHSA 3267R 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3402S 3403F 3404L 3432T 3433G 3548A(T) 3549L(I) 3553E 3561R 3562Q (identity: 92.3 %/95.0 %)
3 c C 1 (A) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 3371P 3463I 3465V(L) 3503E 3509H (identity: 80.0 %/95.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1q2w_A_1 identity=95.0%
queryA      3266:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK:3365
                :******************************** *********    **************** ******************** * ***** ********:
1q2w_A_1       5:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICXXXXMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 104
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG ----  S  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  SEE:    
ExpBur          :eeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbe----eeebebeeebeeeeeeebebebeeeebebeeeeeeebbbebebeeebeebbeee:    
Contact         : b bbbbbb  b                                                                                        

queryA      3366:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV:3465
                :******************************* ********************************************* ********************* :
1q2w_A_1     105:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 204
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS  S       B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebbb:    
Contact         :     c             bbbbbbb        b bbb                           bb                             c c

queryA      3466:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS:3564
                :**************************************************************** *****************  ***************:
1q2w_A_1     205:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 303
SecStr          :HHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHH  :    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebbbbbbbebbeeebe:    
Contact         :                                     c     c                                      bb   b       bb   


Input Residue Numbers for Focused Sites

ex) 2,15,123