#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1wof assembly_id=1

Protein Model on 1wof assembly_id=1 (TEMPLATE: 1wof assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [309 aa] 3C-like proteinase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_CVHSA 3264S 3267R 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3378L 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3548A(T) 3549L(I) 3553E 3562Q 3563C 3564S 3565G 3566V 3567T 3568F (identity: 94.1 %/96.1 %)
3 c C 1 (A) non-polymer(I12) N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VALYL-N~1~-((1S)-4-ETHOXY-4-OXO-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3288T 3289T 3304H 3312M 3317Y 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3451R 3452Q 3453T 3454A 3455Q (identity: 100.0 %/96.1 %)
4 d D 1 (B) non-polymer(I12) N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VALYL-N~1~-((1S)-4-ETHOXY-4-OXO-1-{[(3S)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1wof_A_1 identity=96.1%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
1wof_A_1       6:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 105
SecStr          :S         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGGSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :ebbeeeebebeebebbbbbbbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :b  b bbbbbb  b          cc              c       c    c                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
1wof_A_1     106:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 205
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeebbeb:    
Contact         :              b      bbbbbbb        bbbbbcccc                 cccb c   b              cccccc        
Contact         :                                       cc                        c     c                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
1wof_A_1     206:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 305
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbebeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeeeebbbbbebbebbe:    
Contact         :                                                                                    bb   b        bb

queryA      3564:SGVTF:3568
                :*****:
1wof_A_1     306:SGVTF: 310
SecStr          :HT   :    
ExpBur          :eeeee:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123