#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm assembly_id=1

Protein Model on 2ahm assembly_id=1 (TEMPLATE: 2ahm assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description o(query A)
1 a A 1 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4021K 4024K 4025V 4028A 4029M 4031T 4032M 4036M (identity: 100.0 %/97.4 %)
2 b A 2 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
3 c B 1 (B) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
4 d B 2 (B) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3986V 3990E 3993R (identity: 100.0 %/97.4 %)
5 e C 1 (C) polymer(polypeptide(L)) [74 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3947E 3950S 4001L 4002E 4004M 4005A 4008A 4009M 4012M 4013Y (identity: 100.0 %/97.4 %)
6 f C 2 (C) polymer(polypeptide(L)) [74 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
7 g D 1 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4019E 4022R 4025V 4026T 4029M 4030Q 4031T 4033L 4034F 4036M 4037L 4040L 4042N 4044A 4045L 4048I 4049I 4052A 4053R 4055G 4057V 4058P 4061I 4062I 4064L (identity: 100.0 %/97.4 %)
8 h D 2 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
9 i E 1 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 4066T 4067A 4097E 4099Q 4131L 4133A 4134N (identity: 100.0 %/97.4 %)
10 j E 2 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
11 k F 1 (F) polymer(polypeptide(L)) [143 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3950S 3993R 3994D 3996A 3997M 3999R 4000K (identity: 100.0 %/97.4 %)
12 l F 2 (F) polymer(polypeptide(L)) [143 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3982K 3985N 3986V 3988K 3989S 3992D 3993R (identity: 100.0 %/97.4 %)
13 m G 1 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3947E 4005A 4006D 4009M 4013Y 4059L 4060N 4061I 4064L 4065T 4073V (identity: 100.0 %/97.4 %)
14 n G 2 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
15 o A(queryA) H 1 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
16 p H 2 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
17 q I 1 (A) non-polymer(GOL) GLYCEROL
18 r I 2 (A) non-polymer(GOL) GLYCEROL
19 s J 1 (E) non-polymer(GOL) GLYCEROL
20 t J 2 (E) non-polymer(GOL) GLYCEROL
21 u K 1 (E) non-polymer(GOL) GLYCEROL
22 v K 2 (E) non-polymer(GOL) GLYCEROL
23 w L 1 (F) non-polymer(GOL) GLYCEROL
24 x L 2 (F) non-polymer(GOL) GLYCEROL
25 y M 1 (F) non-polymer(GOL) GLYCEROL
26 z M 2 (F) non-polymer(GOL) GLYCEROL
27 1 N 1 (H) non-polymer(SO4) SULFATE ION 4077Y 4081K 4115S(N) 4116M (identity: 75.0 %/97.4 %)
28 2 N 2 (H) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[15] Protein A "queryA" TEMPLATE:2ahm_H_1 identity=97.4%
queryA      3944:IASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND:4043
                :************* **************************************************************************************:
2ahm_H_1       7:IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND: 106
SecStr          :   S TTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  H:    
ExpBur          :eeeeeeebebeeeeeebeeeeeebeeeeeeeeebeeeeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeeee:    
Contact         :   e  e                               l  ld lld ldk kk kkee eem ee  ee     g ag aag aagaagg ag  g g 
Contact         :   m  k                                   l      k           m   m   m           g   g g    g       
Contact         :                                                 l                                                  

queryA      4044:ALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :****************************** *** ******** *************************** *******************:
2ahm_H_1     107:ALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :HHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEEETTEEEEEEEEE TTS B  GGG SGGGSTTS SSEEEEEEE  :    
ExpBur          :eeeeebebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeebe:    
Contact         :gg  gg  gg g ggmmgg gmii     m   1   1               i i               11              i ii         
Contact         :                 m  m                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123