#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm assembly_id=1

Protein Model on 2ahm assembly_id=1 (TEMPLATE: 2ahm assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description m(query A)
1 a A 1 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3986V 3990E 3993R (identity: 100.0 %/97.4 %)
3 c B 1 (B) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4021K 4024K 4025V 4028A 4029M 4032M 4036M (identity: 100.0 %/97.4 %)
4 d B 2 (B) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
5 e C 1 (C) polymer(polypeptide(L)) [74 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4022R 4025V 4026T 4029M 4030Q 4033L 4036M 4037L 4040L 4042N 4044A 4045L 4048I 4049I 4052A 4053R 4057V 4058P 4061I 4062I 4064L 4073V (identity: 100.0 %/97.4 %)
6 f C 2 (C) polymer(polypeptide(L)) [74 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
7 g D 1 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3950S 4002E 4004M 4005A 4008A 4009M 4011Q 4012M (identity: 100.0 %/97.4 %)
8 h D 2 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA
9 i E 1 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3992D 3993R 3994D 3996A 3997M 3999R 4000K (identity: 100.0 %/97.4 %)
10 j E 2 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3982K 3985N 3986V 3988K 3989S 3992D 3993R (identity: 100.0 %/97.4 %)
11 k F 1 (F) polymer(polypeptide(L)) [143 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
12 l F 2 (F) polymer(polypeptide(L)) [143 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
13 m A(queryA) G 1 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
14 n G 2 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
15 o H 1 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 3947E 4005A 4006D 4009M 4013Y 4059L 4060N 4061I 4064L (identity: 100.0 %/97.4 %)
16 p H 2 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
17 q I 1 (A) non-polymer(GOL) GLYCEROL
18 r I 2 (A) non-polymer(GOL) GLYCEROL
19 s J 1 (E) non-polymer(GOL) GLYCEROL
20 t J 2 (E) non-polymer(GOL) GLYCEROL
21 u K 1 (E) non-polymer(GOL) GLYCEROL
22 v K 2 (E) non-polymer(GOL) GLYCEROL
23 w L 1 (F) non-polymer(GOL) GLYCEROL
24 x L 2 (F) non-polymer(GOL) GLYCEROL
25 y M 1 (F) non-polymer(GOL) GLYCEROL
26 z M 2 (F) non-polymer(GOL) GLYCEROL
27 1 N 1 (H) non-polymer(SO4) SULFATE ION
28 2 N 2 (H) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[13] Protein A "queryA" TEMPLATE:2ahm_G_1 identity=97.4%
queryA      3943:AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN:4042
                :************** *************************************************************************************:
2ahm_G_1       6:AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN: 105
SecStr          :  GGGSTTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  :    
ExpBur          :eeeeeeeebebeeebeebeeeeeebeeeeeeeebbeebeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeee:    
Contact         :    o  g                               j  jb jjb ibi ii ii g ggo gg ggo       ce cce cce ce  ce  e e
Contact         :                                           j     ji           o   o               e   e      e      
Contact         :                                                  j                                                 

queryA      4043:DALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :******************************* *** ******** *************************** ******************:
2ahm_G_1     106:DALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRA: 196
SecStr          :HHHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEE SSSEEEEEEEE TTS B  STT STTTGGGS SSEEEEEEE :    
ExpBur          :eeeeeeeebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeee:    
Contact         : ee  ee  ee   eeooee e        e                                                                     
Contact         :                  o  o                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123