#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2vj1 assembly_id=1

Protein Model on 2vj1 assembly_id=1 (TEMPLATE: 2vj1 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [300 aa] SARS CORONAVIRUS MAIN PROTEINASE :A7J8L3_CVHSA 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3548A(T) 3549L(I) 3553E 3562Q 3563C (identity: 92.3 %/96.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] SARS CORONAVIRUS MAIN PROTEINASE :A7J8L3_CVHSA
3 c C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
4 d D 1 (A) non-polymer(BEZ) BENZOIC ACID
5 e E 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 3268K 3269M 3270A 3389Y 3390Q (identity: 100.0 %/96.0 %)
6 f F 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 3506T 3507Q 3508D (identity: 100.0 %/96.0 %)
7 g G 1 (B) non-polymer(XP1) 4-(DIMETHYLAMINO)BENZOIC ACID 3404L 3405N 3406G 3408C 3426H 3429E (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:2vj1_B_1 identity=96.0%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY:3364
                :********************************* ********** ****************** ******************** * ***** *******:
2vj1_B_1       1:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 100
SecStr          :  S      HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHTS  HHHHHTT  STT EEEETTEEE EEEEEEETTEEEEEESS  TT  EE:    
ExpBur          :beeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeebbee:    
Contact         : aaaaaaaaa  a                                                                                       
Contact         :   eee                                                                                              

queryA      3365:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT:3464
                :******************************** ********************************************* *********************:
2vj1_B_1     101:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 200
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B SS  TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B H:    
ExpBur          :eeeebeebebbbbbbbeeeeeeeeebbbbbbbebbeeeebeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeebebb:    
Contact         :                    aaaaaaa        aaaaggg g                 g  g                                   
Contact         :                        ee                                                                          

queryA      3465:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS:3564
                : **************************************************************** *****************  ***************:
2vj1_B_1     201:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 300
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHT :    
ExpBur          :bbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebbebeebebbbbbebbeebbe:    
Contact         :                                         fff                                       aa   a        aa 


Input Residue Numbers for Focused Sites

ex) 2,15,123