#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23 assembly_id=1

Protein Model on 3d23 assembly_id=1 (TEMPLATE: 3d23 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1
2 b B 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1
3 c C 1 (C) polymer(polypeptide(L)) [298 aa] 3C-like proteinase :R1AB_CVHN1 3318E(S) 3322I(C) 3326N(L) 3341I(V) 3342G(S) 3343H(Y) 3344S(Q) 3345M (identity: 12.5 %/49.7 %)
4 d D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 3297D 3335N(R) 3337Q(S) 3355D(S) 3356T(L) 3357A(Q) 3358N 3359P (identity: 37.5 %/49.7 %)
5 e E 1 (H) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3290L 3304H 3403F 3404L 3405N(C) 3406G 3408C 3426H 3427H(Q) 3428M(L) 3429E 3430L 3435H 3450D 3452Q 3453T(V) 3454A(V) 3455Q (identity: 72.2 %/49.7 %)
6 f F 1 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
7 g G 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE
8 h H 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3336V(M) 3356T(L) 3359P 3360K(Y) (identity: 25.0 %/49.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_A_1 identity=49.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_A_1       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          : S        TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  SSSTTS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeeeeebeebbbbbebeebebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebeeeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :                          e      d      e             c   c   c        dhd   ccccc         dddddh   
Contact         :                                                                                            h  h    

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_A_1     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE  TT EEEEEEEEEEEETTEEEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                                       eeee e                 eeeee    e              e eeee        

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_A_1     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHHT-  TT  BTTBSS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeee--beebbeebebebebbbbbbeebee-ebeeeebeebeebebebbbebbeeee:    

queryA      3564:SGV:3566
                : **:
3d23_A_1     300:AGV: 302
SecStr          :H  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123