#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3vb3 assembly_id=1

Protein Model on 3vb3 assembly_id=1 (TEMPLATE: 3vb3 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1A_CVHSA 3264S 3265G 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3433G 3435H 3546G 3548A(T) 3549L(I) 3553E 3562Q 3564S (identity: 94.1 %/96.0 %)
3 c C 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3267R 3268K 3389Y 3390Q (identity: 100.0 %/96.0 %)
4 d D 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 3394R 3400K 3551E 3552D 3553E (identity: 100.0 %/96.0 %)
5 e E 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 3368R 3397F(H) 3445Y 3446G (identity: 75.0 %/96.0 %)
6 f F 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 3285C 3286G 3287T 3306I 3308T 3324K (identity: 100.0 %/96.0 %)
7 g G 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 3298V(T) 3343H 3344S 3351K(R) 3353K (identity: 60.0 %/96.0 %)
8 h H 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 3396N 3397F(H) 3447P 3448F 3457A 3458G (identity: 83.3 %/96.0 %)
9 i I 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL
10 j J 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3vb3_A_1 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3vb3_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeebbe:    
Contact         :bb bbbbbbbb  b       fff          g       f f               f                  gg      g g          
Contact         :   cc                                                                                               

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3vb3_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :    e            b  bbbbbbbb  d he  bbbbb                        b   b b         eehh        hh     
Contact         :                         cc      h  d                                                               

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3vb3_A_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeee:    
Contact         :                                                                                  b bb ddb        b 
Contact         :                                                                                         d          

queryA      3564:S:3564
                :*:
3vb3_A_1     301:S: 301
SecStr          : :    
ExpBur          :e:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123