#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yog assembly_id=1

Protein Model on 4yog assembly_id=1 (TEMPLATE: 4yog assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 3264S 3265G 3266F(L) 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3386S(T) 3387G 3388V 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3548A(S) 3549L(T) 3561R(M) 3562Q 3564S(M) 3566V 3569Q (identity: 69.7 %/51.0 %)
3 c C 1 (A) non-polymer(ACT) ACETATE ION 3277E 3278G(N) (identity: 50.0 %/51.0 %)
4 d D 1 (A) non-polymer(ACT) ACETATE ION 3296D 3358N 3361T (identity: 100.0 %/51.0 %)
5 e E 1 (A) non-polymer(ACT) ACETATE ION 3496V(W) (identity: 0.0 %/51.0 %)
6 f F 1 (A) non-polymer(ACT) ACETATE ION 3394R 3460D 3461T(K) 3462T(Y) (identity: 50.0 %/51.0 %)
7 g G 1 (A) non-polymer(4F5) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-(tert-butylamino)-2-oxo-1-(thiophen-3-yl)ethyl]acetamide 3288T(M) 3304H 3307C 3309S(A) 3312M(L) 3403F 3404L 3405N(C) 3408C 3426H 3428M 3429E 3450D 3451R(K) 3452Q (identity: 66.7 %/51.0 %)
8 h H 1 (B) non-polymer(ACT) ACETATE ION
9 i I 1 (B) non-polymer(ACT) ACETATE ION 3274G (identity: 100.0 %/51.0 %)
10 j J 1 (B) non-polymer(ACT) ACETATE ION
11 k K 1 (B) non-polymer(4F5) N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)-N-[(1R)-2-(tert-butylamino)-2-oxo-1-(thiophen-3-yl)ethyl]acetamide
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yog_A_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yog_A_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHHS GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bbbbbbb bbb  bc         g       d       g  g g  g                                                d  
Contact         :          i  c                                                                                      

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yog_A_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BSSS  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeebbbbbbbbeeeeeebbbbbbbbbeeeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :d                        bbbb    f     bbbbbg  g                 g gb  bb b              ggg       f
Contact         :                                          gg                        g                               

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yog_A_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HHHHH---HHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbbeebeebeeeeebeeeebeeebeeeebbebeeeeebee---bbeebebebeebbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :ff              b                  e                                                  b bb          

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
4yog_A_1     297:NMQVMGVVMQ: 306
SecStr          :HHHTTT    :    
ExpBur          :eebbeebeee:    
Contact         : bb b b  b                                                                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123