#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5r81 assembly_id=1

Protein Model on 5r81 assembly_id=1 (TEMPLATE: 5r81 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2 3264S 3265G 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3546G 3548A 3549L 3553E 3562Q 3563C 3564S 3565G 3566V 3567T (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(RZJ) 1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide 3304H 3312M 3428M 3429E 3431P 3450D 3451R 3452Q 3453T (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(RZJ) 1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3337Q 3338L 3339R (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3269M 3271F 3390Q 3561R (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3386S (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3278G 3280M 3334G 3360K (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3403F 3404L 3407S 3408C 3426H 3428M 3429E 3435H (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5r81_A_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
5r81_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHTT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :bbbbbbbbbbb  bi i                       c       c                     i  eee                    i   
Contact         :     g g                                                                                            

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
5r81_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TT  BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                 b  bbbbbbb         bbbbb  kk                 k cb c   b              cccc          
Contact         :                      h   g            kk                       kc     k                            
Contact         :                                                                 k                                  

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
5r81_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebeeeeebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeee:    
Contact         :                                                                                  b bb   b       gbb

queryA      3564:SGVT:3567
                :****:
5r81_A_1     301:SGVT: 304
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :bbbb                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123