#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5rea assembly_id=1

Protein Model on 5rea assembly_id=1 (TEMPLATE: 5rea assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2 3264S 3265G 3266F 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3391C 3400K 3401G 3402S 3403F 3404L 3429E 3435H 3543T 3546G 3548A 3549L 3553E 3562Q 3563C 3564S 3565G 3566V 3567T (identity: 100.0 %/100.0 %)
2 b A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] 3C-like proteinase :R1AB_SARS2
3 c B 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
4 d B 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3337Q 3338L 3339R (identity: 100.0 %/100.0 %)
5 e C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
6 f C 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3327H 3328N 3330L (identity: 100.0 %/100.0 %)
7 g D 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3386S (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3269M 3270A 3271F 3390Q 3561R (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(JGP) (azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone
10 j E 2 (A) non-polymer(JGP) (azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone 3540N 3541G 3542R (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5rea_A_2 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
5rea_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebebeeeebebeeeebeebbbebebeeebeeebe:    
Contact         :aaaaaaaaaaa  a                                                 ff f      ddd                        
Contact         :     hhh                                                                                            

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
5rea_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                 a  aaaaaaaa        aaaaa                        a     a                            
Contact         :                      g   h                                                                         

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
5rea_A_2     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeebebbbbbebbeeee:    
Contact         :                                                                            jjja  a aa   a       haa

queryA      3564:SGVT:3567
                :****:
5rea_A_2     301:SGVT: 304
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :aaaa                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123