#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkm assembly_id=1

Protein Model on 5wkm assembly_id=1 (TEMPLATE: 5wkm assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b A 2 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC 3263Q(H) 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3404L 3431P(A) 3432T(N) 3433G 3434V(T) 3546G 3548A(T) 3549L(M) 3561R(M) 3562Q 3565G (identity: 56.7 %/52.0 %)
3 c B 1 (A) non-polymer(N02) (1S,2S)-2-{[N-({[1-(tert-butoxycarbonyl)-4-ethylpiperidin-4-yl]oxy}carbonyl)-L-leucyl]amino}-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 3403F 3404L 3405N(C) 3406G 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3435H 3450D 3451R(K) (identity: 76.9 %/52.0 %)
4 d B 2 (A) non-polymer(N02) (1S,2S)-2-{[N-({[1-(tert-butoxycarbonyl)-4-ethylpiperidin-4-yl]oxy}carbonyl)-L-leucyl]amino}-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkm_A_1 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkm_A_1       7:HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPXXQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :  S        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  --  SS  HHHHHHH  GGG EEE   --- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbebeebebbbbbbeeebbbbbbbbbe--eeeeeebeebbeebeeeebebebee---eebebebeeeeebbbebebeeebe:    
Contact         :b b bbbbbbbb  b                                                                                     

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkm_A_1     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbeebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    
Contact         :                         bbbbb          bbbcbcccc                 cccc bbbbc              cc        
Contact         :                                            c                                                       

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkm_A_1     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHTTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHH   HHHHHHHHHHHH-H   S  BTTBSS   SS HHH:    
ExpBur          :eeebbbbbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeeeeebebbbbbeb:    
Contact         :                                                                                       b bb         

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkm_A_1     303:VNMQIMGV: 310
SecStr          :HHHHHH  :    
ExpBur          :bbeeeeee:    
Contact         :  bb  b                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123