#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xez assembly_id=1

Protein Model on 6xez assembly_id=1 (TEMPLATE: 6xez assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [926 aa] nsp12 :R1AB_SARS2 4018S 4021K 4022R 4024K 4025V 4026T 4029M 4030Q 4036M 4037L 4039K 4042N 4046N 4052A 4055G 4056C 4057V 4058P 4059L 4060N 4061I 4062I 4063P 4064L 4067A 4069K 4070L 4071M 4072V 4073V 4075P 4104A 4125P 4127I (identity: 100.0 %/100.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
3 c C 1 (C) polymer(polypeptide(L)) [73 aa] nsp7 :R1AB_SARS2 4105D 4120P (identity: 100.0 %/100.0 %)
4 d D 1 (D) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
5 e E 1 (E) polymer(polypeptide(L)) [596 aa] nsp13 :R1AB_SARS2
6 f F 1 (F) polymer(polypeptide(L)) [596 aa] nsp13 :R1AB_SARS2 4001L 4004M 4005A 4009M 4012M 4013Y (identity: 100.0 %/100.0 %)
7 g G 1 (P) polymer(polyribonucleotide) Product RNA 3992D 3996A (identity: 100.0 %/100.0 %)
8 h H 1 (T) polymer(polyribonucleotide) Template RNA 3985N 4003K (identity: 100.0 %/100.0 %)
9 i I 1 (A) non-polymer(ZN) ZINC ION
10 j J 1 (A) non-polymer(ZN) ZINC ION
11 k K 1 (A) non-polymer(MG) MAGNESIUM ION
12 l L 1 (A) non-polymer(ADP) ADENOSINE-5'-DIPHOSPHATE
13 m M 1 (A) non-polymer(1N7) CHAPSO
14 n N 1 (A) non-polymer(1N7) CHAPSO
15 o O 1 (E) non-polymer(ZN) ZINC ION
16 p P 1 (E) non-polymer(ZN) ZINC ION
17 q Q 1 (E) non-polymer(ZN) ZINC ION
18 r R 1 (E) non-polymer(ADP) ADENOSINE-5'-DIPHOSPHATE
19 s S 1 (E) non-polymer(AF3) ALUMINUM FLUORIDE
20 t T 1 (E) non-polymer(MG) MAGNESIUM ION
21 u U 1 (E) non-polymer(1N7) CHAPSO
22 v V 1 (F) non-polymer(ZN) ZINC ION
23 w W 1 (F) non-polymer(ZN) ZINC ION
24 x X 1 (F) non-polymer(ZN) ZINC ION
25 y Y 1 (F) non-polymer(ADP) ADENOSINE-5'-DIPHOSPHATE
26 z Z 1 (F) non-polymer(AF3) ALUMINUM FLUORIDE
27 1 AA 1 (F) non-polymer(MG) MAGNESIUM ION
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:6xez_B_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6xez_B_1       7:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 106
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :eeeeebeeeeeeeeeebeeeeeeeeeeeeeeebeeeeeebeeebebbeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebee:    
Contact         :                                     h      g   g    f hff   f  ff    a  aa aaa  aa     aa a  a   a 

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6xez_B_1     107:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 192
SecStr          :HHHHSSSS   STHHHHHH     B  SSHHHHHHHS SSEEE SSSEEE   EEETTS B  TTT  GGG TTS S EEE  EE :    
ExpBur          :beeeeeeeeeeeeebeeebeeebebebeebeebeeebeeeebeeeeeebebeebbbeeeeebeeeebeeebeeebeeebebbbeee:    
Contact         :    a  aaaaaaaaaa  a aaaaa a                            ac              c    a a                    


Input Residue Numbers for Focused Sites

ex) 2,15,123