#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yvf assembly_id=1

Protein Model on 6yvf assembly_id=1 (TEMPLATE: 6yvf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b A 2 (A) polymer(polypeptide(L)) [306 aa] Replicase polyprotein 1ab :R1AB_SARS2 3264S 3265G 3267R 3268K 3269M 3270A 3271F 3272P 3273S 3274G 3277E 3381Y 3384S 3385P 3386S 3387G 3388V 3389Y 3390Q 3400K 3401G 3402S 3403F 3404L 3429E 3433G 3435H 3543T 3546G 3548A 3549L 3553E 3561R 3562Q 3563C 3564S 3565G 3566V 3567T 3568F (identity: 100.0 %/100.0 %)
3 c B 1 (A) non-polymer(A82) 2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylidene-pyrido[1,2-a]pyrimidin-9-yl)ethyl]amino]benzoic acid 3326N 3341I 3342G 3343H 3344S 3351K 3353K (identity: 100.0 %/100.0 %)
4 d B 2 (A) non-polymer(A82) 2-[[(1R)-1-(7-methyl-2-morpholin-4-yl-4-oxidanylidene-pyrido[1,2-a]pyrimidin-9-yl)ethyl]amino]benzoic acid
5 e C 1 (A) non-polymer(CL) CHLORIDE ION 3278G 3294W 3358N 3359P 3360K (identity: 100.0 %/100.0 %)
6 f C 2 (A) non-polymer(CL) CHLORIDE ION
7 g D 1 (A) non-polymer(CL) CHLORIDE ION 3277E (identity: 100.0 %/100.0 %)
8 h D 2 (A) non-polymer(CL) CHLORIDE ION 3272P 3273S 3274G 3275K (identity: 100.0 %/100.0 %)
9 i E 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3337Q 3338L 3339R (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
11 k F 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3278G 3280M 3360K (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
13 m G 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3403F 3404L 3405N 3407S 3426H 3428M 3429E (identity: 100.0 %/100.0 %)
14 n G 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3264S (identity: 100.0 %/100.0 %)
15 o H 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3364Y 3366F (identity: 100.0 %/100.0 %)
16 p H 2 (A) non-polymer(DMS) DIMETHYL SULFOXIDE
17 q I 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3286G 3327H 3328N 3330L (identity: 100.0 %/100.0 %)
18 r I 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
19 s J 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3324K 3325S (identity: 100.0 %/100.0 %)
20 t J 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
21 u K 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3501N (identity: 100.0 %/100.0 %)
22 v K 2 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER
23 w L 1 (A) non-polymer(CA) CALCIUM ION 3363K (identity: 100.0 %/100.0 %)
24 x L 2 (A) non-polymer(CA) CALCIUM ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yvf_A_1 identity=100.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :****************************************************************************************************:
6yvf_A_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeebbeebebeeebeeeeeeebebebeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbbh be k     q       e                             sscqq q      iii cccc      c c    eee  w
Contact         :n       hhh  gk                                                                                 k   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :****************************************************************************************************:
6yvf_A_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeeb:    
Contact         :o o              b  bbbbbbb         bbbbbm m                  m mb   b b                            
Contact         :                                       mm                        m                                  

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :****************************************************************************************************:
6yvf_A_1     201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHTTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebbebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbebbe:    
Contact         :                                     u                                         b  b bb   b       bbb

queryA      3564:SGVTFQ:3569
                :******:
6yvf_A_1     301:SGVTFQ: 306
SecStr          :HT    :    
ExpBur          :eeeeee:    
Contact         :bbbbb                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123