#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jit assembly_id=1

Protein Model on 7jit assembly_id=1 (TEMPLATE: 7jit assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [314 aa] Papain-like protease :R1A_SARS2
2 b B 1 (A) non-polymer(Y95) 5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]benzamide 1725L 1726G 1727D 1730E 1810P 1811P 1827Y 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/99.7 %)
3 c C 1 (A) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/99.7 %)
4 d D 1 (A) non-polymer(ZN) ZINC ION 1580H 1626T 1630E (identity: 100.0 %/99.7 %)
5 e E 1 (A) non-polymer(ZN) ZINC ION 1652H 1671D (identity: 100.0 %/99.7 %)
6 f F 1 (A) non-polymer(ZN) ZINC ION 1636H (identity: 100.0 %/99.7 %)
7 g G 1 (A) non-polymer(CL) CHLORIDE ION 1573T 1574V 1575D 1578N 1580H 1630E (identity: 100.0 %/99.7 %)
8 h H 1 (A) non-polymer(CL) CHLORIDE ION 1636H 1691N 1692P 1738H (identity: 100.0 %/99.7 %)
9 i I 1 (A) non-polymer(CL) CHLORIDE ION 1636H (identity: 100.0 %/99.7 %)
10 j J 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 1602A 1603D 1651N (identity: 100.0 %/99.7 %)
11 k K 1 (A) non-polymer(ACT) ACETATE ION 1669W 1672N 1673N 1674C(S) 1725L 1834G 1835H (identity: 85.7 %/99.7 %)
12 l L 1 (A) non-polymer(ACT) ACETATE ION 1727D 1729R 1730E 1771M 1831Y (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jit_A_1 identity=99.7%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
7jit_A_1       5:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 104
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebebbbbeeeeeeeebebeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeeb:    
Contact         :        ggg  g d                     jj                      d   d     f              je            
Contact         :               g                                                 g     h                            
Contact         :                                                                       i                            

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :********* ******************************************************************************************:
7jit_A_1     105:TSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 204
SecStr          :E   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEET:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeebebeebbeebbeebebeebebbbbeebeeeeeeeeeeeb:    
Contact         :    k ekkk                hh                                bbb lb       h             c  c         
Contact         :                                                            k l  l                                  

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
7jit_A_1     205:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 304
SecStr          :HHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEESSTTT EEEEEEESSSEEEEETTEEEEES EEEEEE:    
ExpBur          :bebbbbeebbebeebbebbebebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebb:    
Contact         :      l               c c                    bb               b   bb kkb                           b
Contact         :                                                                  l                                 

queryA      1865:DVFYKENSYTTTIK:1878
                :**************:
7jit_A_1     305:DVFYKENSYTTTIK: 318
SecStr          :EEEEE SEEE    :    
ExpBur          :bbbbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123