#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ow0 assembly_id=2

Protein Model on 4ow0 assembly_id=2 (TEMPLATE: 4ow0 assembly_id:2 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [260 aa] papain-like protease :R1A_CVHSA
2 b H 1 (B) non-polymer(ZN) ZINC ION 1752C 1754T(H) 1755C 1787C 1789C (identity: 80.0 %/80.8 %)
3 c I 1 (B) non-polymer(S88) N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-ylethyl]piperidine-4-carboxamide 1725L 1726G 1727D 1810P 1811P 1827Y 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/80.8 %)
4 d J 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 1761T 1763K(T) (identity: 50.0 %/80.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ow0_B_1 identity=80.8%
queryA      1619:YVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC:1718
                : *** ***** ******** * ***************** *** *********** **   ** *** * *** **** ******** *********** :
4ow0_B_1      57:FVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNUYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYS: 156
SecStr          :     SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHH:    
ExpBur          :eeebeeeeeeeebeeebeeeeeebbeebeebbeebeebebeebeebbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbb:    

queryA      1719:NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKH:1818
                :**************  * ***** * ********* ***  *** *************   * ** *** **  ** ******* ********* * *  :
4ow0_B_1     157:NKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQ: 256
SecStr          :T  TT    HHHHHHHHGGGBS TT EEEEEEEETTTEEEEEEEETHHHHEEES S HHHHHH EEE  TTSS EEEEEEEEESSEEEEEEEEEEEEEET:    
ExpBur          :eeebeeebebeebbeebbebbebeebebbbbbebeeeeeeeeebeeeebbbbeebbbbeebbeebeeeeeeeeebebbbeebebbbbbbbbeeeeeebee:    
Contact         :      ccc                        b bb     d d                       b b                    cc       

queryA      1819:GTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK:1878
                :*** ** *********** *** ***** **** *** ****** ******* *******:
4ow0_B_1     257:GTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIK: 316
SecStr          :TS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEESEEEEEEEEEEEE SEEE    :    
ExpBur          :eebebbbbbeeeeeebebbbbbbeeebbebebeeeeebeebebebbbbbbebeebebeee:    
Contact         :        c   cc   c                           c                                                      


Input Residue Numbers for Focused Sites

ex) 2,15,123