#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6woj assembly_id=2

Protein Model on 6woj assembly_id=2 (TEMPLATE: 6woj assembly_id:2 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [170 aa] Non-structural protein 3 :R1AB_SARS2
2 b F 1 (B) non-polymer(APR) ADENOSINE-5-DIPHOSPHORIBOSE 1043A 1044D 1045I 1060A 1062N 1066K 1067H 1068G 1069G 1070G 1071V 1072A 1147P 1148L 1150S 1151A 1152G 1153I 1154F 1176A 1178F 1182L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6woj_B_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6woj_B_1       4:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 103
SecStr          :     S EE SSSEEEEES HHHHHHHH  SEEEEEE TT    SSHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEEE   GGG:    
ExpBur          :eeebeebeebbebbbbeebebbebbeebebebbbbebeeebebeeeebbebbebbeeebbeebeeebeeeeebeebeebebebeebbeebbbbbbbbeee:    
Contact         :                  bbb              b b   bbbbbbb                                                    

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK:1194
                :**********************************************************************:
6woj_B_1     104:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMK: 173
SecStr          :T  TTHHHHHHHGGGGSSEEEE  TTSSTT   HHHHHHHHHHH  SEEEEEE  HHHHHHHHHHHT   :    
ExpBur          :eeeeeebeebbebbeebebbbbbbbbeeebebeeeebbebbbebbebebbbbbeeeeebeebbeebeeee:    
Contact         :                      bb bbbbb                     b b   b                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123