#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2fe8 assembly_id=4

Protein Model on 2fe8 assembly_id=4 (TEMPLATE: 2fe8 assembly_id:4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b A 2 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
3 c B 1 (B) polymer(polypeptide(L)) [314 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1591G 1592Q 1593Q 1594F 1595G 1596P 1598Y 1603D 1605T 1606K 1621L 1623N(S) 1639D 1640P(E) 1641S 1644G 1672N 1828T 1829G 1831Y 1832Q 1847C(R) 1849D (identity: 87.0 %/82.8 %)
4 d B 2 (B) polymer(polypeptide(L)) [314 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1564E 1565V 1566R(K) 1567T 1568I 1586M 1611N(V) 1614E (identity: 75.0 %/82.8 %)
5 e C 1 (C) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1625D 1628R 1638T(L) 1639D 1640P(E) 1746R 1748L 1750V 1760T 1762L 1766E 1769M 1770Y 1771M 1785I 1786P 1788T(V) 1795K(Q) (identity: 77.8 %/82.8 %)
6 f C 2 (C) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA
7 g D 1 (A) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/82.8 %)
8 h D 2 (A) non-polymer(ZN) ZINC ION
9 i E 1 (A) non-polymer(BR) BROMIDE ION 1821F 1822T(L) 1868Y 1869K (identity: 75.0 %/82.8 %)
10 j E 2 (A) non-polymer(BR) BROMIDE ION
11 k F 1 (A) non-polymer(BR) BROMIDE ION 1689K 1690F 1696Q (identity: 100.0 %/82.8 %)
12 l F 2 (A) non-polymer(BR) BROMIDE ION
13 m G 1 (A) non-polymer(BR) BROMIDE ION 1648S 1649A 1721T 1722V (identity: 100.0 %/82.8 %)
14 n G 2 (A) non-polymer(BR) BROMIDE ION
15 o H 1 (A) non-polymer(SO4) SULFATE ION 1636H 1691N 1737Q 1738H (identity: 100.0 %/82.8 %)
16 p H 2 (A) non-polymer(SO4) SULFATE ION
17 q I 1 (B) non-polymer(ZN) ZINC ION
18 r I 2 (B) non-polymer(ZN) ZINC ION
19 s J 1 (B) non-polymer(BR) BROMIDE ION
20 t J 2 (B) non-polymer(BR) BROMIDE ION
21 u K 1 (B) non-polymer(BR) BROMIDE ION
22 v K 2 (B) non-polymer(BR) BROMIDE ION
23 w L 1 (B) non-polymer(BR) BROMIDE ION
24 x L 2 (B) non-polymer(BR) BROMIDE ION
25 y M 1 (B) non-polymer(SO4) SULFATE ION
26 z M 2 (B) non-polymer(SO4) SULFATE ION
27 1 N 1 (C) non-polymer(ZN) ZINC ION
28 2 N 2 (C) non-polymer(ZN) ZINC ION
29 3 O 1 (C) non-polymer(BR) BROMIDE ION
30 4 O 2 (C) non-polymer(BR) BROMIDE ION
31 5 P 1 (C) non-polymer(BR) BROMIDE ION
32 6 P 2 (C) non-polymer(BR) BROMIDE ION
33 7 Q 1 (C) non-polymer(BR) BROMIDE ION
34 8 Q 2 (C) non-polymer(BR) BROMIDE ION
35 9 R 1 (C) non-polymer(SO4) SULFATE ION
36 A R 2 (C) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fe8_A_1 identity=82.8%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
2fe8_A_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbeeebbeeebeebbbebeebeeeebeeebeeeebbbbbeeeebeebbeebbebeeeebbbebbebbeebeebebeebee:    
Contact         :ddddd                 d    cccccc c    c cc    d  d      c c e  e       o eccc  c   mm              
Contact         :                                                                           ee                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
2fe8_A_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeebebbbbbbbbbbbbebebeeeeebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :        c                kko    k                        mm              oo       e e e g  g    e e 

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
2fe8_A_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEES GGG EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbeeebbbbeebeeeeebebeeeeebebebbebebebbbbbbeeeeeebeeeebebbbbeeeeeeebebbbbbeeebbbebebeeeeebeebebbb:    
Contact         :  e  eee             eegeg     e                         ii     cc cc              c c              

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
2fe8_A_1     302:TDVFYKETSYTTTI: 315
SecStr          :EEEEEE SEEE   :    
ExpBur          :bbbbbebeeeeeee:    
Contact         :    ii                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123