#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2fe8 assembly_id=5

Protein Model on 2fe8 assembly_id=5 (TEMPLATE: 2fe8 assembly_id:5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [314 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1591G 1592Q 1593Q 1594F 1595G 1596P 1598Y 1603D 1605T 1606K 1621L 1623N(S) 1639D 1640P(E) 1641S 1644G 1672N 1828T 1829G 1831Y 1832Q 1847C(R) 1849D (identity: 87.0 %/82.8 %)
3 c C 1 (C) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1625D 1628R 1638T(L) 1639D 1640P(E) 1746R 1748L 1750V 1760T 1762L 1766E 1769M 1770Y 1771M 1785I 1786P 1788T(V) 1795K(Q) (identity: 77.8 %/82.8 %)
4 d D 1 (A) non-polymer(ZN) ZINC ION 1752C 1755C 1787C 1789C (identity: 100.0 %/82.8 %)
5 e E 1 (A) non-polymer(BR) BROMIDE ION 1821F 1822T(L) 1868Y 1869K (identity: 75.0 %/82.8 %)
6 f F 1 (A) non-polymer(BR) BROMIDE ION 1689K 1690F 1696Q (identity: 100.0 %/82.8 %)
7 g G 1 (A) non-polymer(BR) BROMIDE ION 1648S 1649A 1721T 1722V (identity: 100.0 %/82.8 %)
8 h H 1 (A) non-polymer(SO4) SULFATE ION 1636H 1691N 1737Q 1738H (identity: 100.0 %/82.8 %)
9 i I 1 (B) non-polymer(ZN) ZINC ION
10 j J 1 (B) non-polymer(BR) BROMIDE ION
11 k K 1 (B) non-polymer(BR) BROMIDE ION
12 l L 1 (B) non-polymer(BR) BROMIDE ION
13 m M 1 (B) non-polymer(SO4) SULFATE ION
14 n N 1 (C) non-polymer(ZN) ZINC ION
15 o O 1 (C) non-polymer(BR) BROMIDE ION
16 p P 1 (C) non-polymer(BR) BROMIDE ION
17 q Q 1 (C) non-polymer(BR) BROMIDE ION
18 r R 1 (C) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fe8_A_1 identity=82.8%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
2fe8_A_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbeeebbeeebeebbbebeebeeeebeeebeeeebbbbbeeeebeebbeebbebeeeebbbebbebbeebeebebeebee:    
Contact         :                           bbbbbb b    b bb              b b c  c       h cbbb  b   gg              
Contact         :                                                                           cc                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
2fe8_A_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeebebbbbbbbbbbbbebebeeeeebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :        b                ffh    f                        gg              hh       c c c d  d    c c 

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
2fe8_A_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEES GGG EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbeeebbbbeebeeeeebebeeeeebebebbebebebbbbbbeeeeeebeeeebebbbbeeeeeeebebbbbbeeebbbebebeeeeebeebebbb:    
Contact         :  c  ccc             ccdcd     c                         ee     bb bb              b b              

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
2fe8_A_1     302:TDVFYKETSYTTTI: 315
SecStr          :EEEEEE SEEE   :    
ExpBur          :bbbbbebeeeeeee:    
Contact         :    ee                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123