#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1lvo assembly_id=1

Protein Model on 1lvo assembly_id=1 (TEMPLATE: 1lvo assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [299 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 1S 2G 4R 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 137K 138G 139S 140F 141L(I) 166E 172H 278G 280T 283G(S) 284S(Y) 285A(G) 290E 298R 299Q 300C(M) 302G (identity: 72.7 %/45.2 %)
3 c G 1 (A) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
4 d H 1 (A) non-polymer(SO4) SULFATE ION 131R 137K 197D(N) (identity: 66.7 %/45.2 %)
5 e I 1 (A) non-polymer(SO4) SULFATE ION 215G 216D(E) 217R 218W (identity: 75.0 %/45.2 %)
6 f J 1 (A) non-polymer(SO4) SULFATE ION 104V(K) 105R(S) (identity: 0.0 %/45.2 %)
7 g K 1 (A) non-polymer(SO4) SULFATE ION 19Q(R) 21T(S) 26T(V) 67L(S) (identity: 0.0 %/45.2 %)
8 h L 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 6M 8F(Q) 111T(S) 112F 113S(N) 295D(E) (identity: 33.3 %/45.2 %)
9 i M 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 108P(A) 130M 131R 132P(S) 133N(Q) 134F(G) (identity: 33.3 %/45.2 %)
10 j N 1 (A) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE 123S(G) 124G(S) (identity: 0.0 %/45.2 %)
11 k O 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL 41H 47E(T) 164H 165M(L) 188R(Q) 189Q(P) (identity: 33.3 %/45.2 %)
12 l P 1 (B) non-polymer(SO4) SULFATE ION
13 m Q 1 (B) non-polymer(SO4) SULFATE ION
14 n R 1 (B) non-polymer(SO4) SULFATE ION
15 o S 1 (B) non-polymer(SO4) SULFATE ION
16 p T 1 (B) non-polymer(DIO) 1,4-DIETHYLENE DIOXIDE
17 q U 1 (B) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_A_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_A_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeeeeeeebebbeeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :bb b bbbbbb  b    g g    g              k     k                   g                                 
Contact         :     h h                                                                                            

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_A_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSS         B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :   ff  i  hhh        bbbbbb  idiii  bbbbb                      kkb  c  b               kk   ccc d   
Contact         :                      jj      i     d                                                               

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_A_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --SGGGHHHHHHH   HHHHHHHHHH-HTT  TT  BTTBSS    S HHHHHHHS:    
ExpBur          :bebbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeb--eeebeebbeebebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeebb:    
Contact         :              eeee                                                           b b  bbb    b    h  bbb

queryA       301:SGV: 303
                : **:
1lvo_A_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123