#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1p9u assembly_id=1

Protein Model on 1p9u assembly_id=1 (TEMPLATE: 1p9u assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [299 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU 1S 2G 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 122P 123S(G) 124G(S) 125V 126Y 127Q(G) 128C(V) 137K 138G 139S 140F 141L(I) 166E 170G 172H 277N(G) 278G 283G(S) 284S(Y) 285A(G) 299Q (identity: 68.8 %/45.2 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU
3 c G 1 (G) polymer(polypeptide(L)) [7 aa] PHQ-VNSTLQ-CHLOROMETHYLKETONE INHIBITOR 41H 52P(I) 54Y 140F 141L(I) 142N(A) 145C 163H 164H 165M(L) 166E 167L 168P(G) 187D 188R(Q) 189Q(P) 190T(S) 191A(M) 192Q (identity: 52.6 %/45.2 %)
4 d I 1 (A) non-polymer(SO4) SULFATE ION
5 e J 1 (A) non-polymer(SO4) SULFATE ION
6 f K 1 (A) non-polymer(SO4) SULFATE ION
7 g L 1 (A) non-polymer(SO4) SULFATE ION
8 h M 1 (A) non-polymer(SO4) SULFATE ION
9 i N 1 (A) non-polymer(MRD) (4R)-2-METHYLPENTANE-2,4-DIOL
10 j O 1 (B) non-polymer(SO4) SULFATE ION 169T(N) 193A(L) 194A(E) 195G (identity: 25.0 %/45.2 %)
11 k P 1 (B) non-polymer(SO4) SULFATE ION 35V(E) 37Y(I) 83Q(K) 103F 177L(F) (identity: 20.0 %/45.2 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1p9u_B_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1p9u_B_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEESSS EE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeebeeeebebbbeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :aa aaaaaaaa  a                    k k   c          c c                            k                 

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1p9u_B_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeebeeb:    
Contact         :  k                  aaaaaaa        aaaaac  c                 cccaccja a    k         ccccccjjj     
Contact         :                                       cc                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1p9u_B_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHTTT:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebebeebbebbeeeebeebee--eeebeebeeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :                                                                            aa    aaa             a 

queryA       301:SGV: 303
                : **:
1p9u_B_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123