#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1uk4 assembly_id=1

Protein Model on 1uk4 assembly_id=1 (TEMPLATE: 1uk4 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHSA 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 139S 140F 285A(T) 286L(I) 290E 298R 299Q 300C 301S 302G (identity: 93.3 %/96.0 %)
2 b A(queryA) B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_CVHSA
3 c C 1 (G) polymer(polypeptide(L)) [5 aa] 5-mer peptide of inhibitor
4 d D 1 (H) polymer(polypeptide(L)) [5 aa] 5-mer peptide of inhibitor 25T 41H 49M 143G 144S 145C 164H 165M 166E 168P 188R 189Q 190T 191A 192Q (identity: 100.0 %/96.0 %)
5 e E 1 (K) polymer(polypeptide(L)) [5 aa] 5-mer peptide of inhibitor 62S 63N 64H (identity: 100.0 %/96.0 %)
6 f F 1 (A) non-polymer(ATO) CHLOROACETONE
7 g G 1 (B) non-polymer(ATO) CHLOROACETONE 145C 163H 164H 166E (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:1uk4_B_1 identity=96.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
1uk4_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEE  GGGG  TGGGGS  HHHHHHT  GGGEEEEETTEEE EEEEE  TT  EEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebeeeeebebbbebebeeebeebbe:    
Contact         :aaaaaaaaaaa  a          d               d       d            eee                                    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
1uk4_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B  S  SS TT EEEEEETTEEEEEEEEEE  SSSSBEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbebeebeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                     aaaaaaa        a aa  ddd                 gddd d                   ddddd        
Contact         :                                            g                  g g                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
1uk4_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHT:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebbbbbebbeeee:    
Contact         :                                                                                    aa   a       aaa

queryA       301:SG: 302
                :**:
1uk4_B_1     301:SG: 302
SecStr          :T :    
ExpBur          :ee:    
Contact         :aa                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123