#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2a5k assembly_id=1

Protein Model on 2a5k assembly_id=1 (TEMPLATE: 2a5k assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] 3C-like peptidase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [300 aa] 3C-like peptidase :R1AB_CVHSA 1S 2G 4R 5K 6M 7A 8F 9P 10S 11G 14E 115L 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 166E 170G 285A(T) 286L(I) 290E 298R 299Q 300C 301S 302G 303V 304T (identity: 94.3 %/96.1 %)
3 c C 1 (A) non-polymer(AZP) (5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZYL-14-HYDROXY-5-ISOBUTYL-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,11-TETRAAZAPENTADECAN-15-OATE 25T 26T 41H 44C 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 172H 185F 187D 188R 189Q 190T 192Q (identity: 100.0 %/96.1 %)
4 d D 1 (B) non-polymer(AZP) (5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZYL-14-HYDROXY-5-ISOBUTYL-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,11-TETRAAZAPENTADECAN-15-OATE
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2a5k_A_1 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
2a5k_A_1       2:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 101
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeebeeebebeebbeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :bb bbbbbbbb  b          cc              c  c    c    c                                              

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
2a5k_A_1     102:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 201
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeeb:    
Contact         :              b      bbbbbbb        bbbcbcccc                 cccbc  b c            c cccc c        
Contact         :                                        c                        c                                  

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
2a5k_A_1     202:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 301
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebbebeebebbbbbebbebee:    
Contact         :                                                                                    bb   b       bbb

queryA       301:SGVT: 304
                :****:
2a5k_A_1     302:SGVT: 305
SecStr          :HT  :    
ExpBur          :eeee:    
Contact         :bbbb                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123